Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RBA7

Protein Details
Accession N1RBA7    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
279-305EDAKPYCYMKSPKNPHRCGRHGGKQGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 8, cysk 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
CDD cd09917  F-box_SF  
Amino Acid Sequences MVQLLADPAFSPAGTPTHEGTNGPLMKRPGLGRTDSSTPMTREEHAKRMQELNKKRGLMRAPRRGWSMTDYQGDHVAGSHSGASHIERQAPIPENESPPPSTPYQHSTPEVPAEDKAAQLPHRPKLPPPRRSYSVMDYEPVPQTQPQPPKDHTLLDLPSELHYTIFDHLDPIDSVCFGLTNSNFYEIHRRLHGTVPLSSRYSGPNDMEWAWRGAGPLVHRHERNPEKEDPMGQMRVKGQVYCRKCGISRCELHRHLKDWMGDGYEYCSIKEIFGKPAGEDAKPYCYMKSPKNPHRCGRHGGKQGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.2
5 0.22
6 0.22
7 0.23
8 0.3
9 0.31
10 0.29
11 0.32
12 0.31
13 0.31
14 0.35
15 0.34
16 0.31
17 0.31
18 0.34
19 0.33
20 0.36
21 0.39
22 0.38
23 0.4
24 0.38
25 0.35
26 0.36
27 0.34
28 0.32
29 0.36
30 0.38
31 0.42
32 0.45
33 0.47
34 0.46
35 0.53
36 0.58
37 0.59
38 0.63
39 0.63
40 0.63
41 0.62
42 0.6
43 0.58
44 0.59
45 0.6
46 0.61
47 0.64
48 0.61
49 0.63
50 0.65
51 0.6
52 0.54
53 0.48
54 0.44
55 0.38
56 0.38
57 0.35
58 0.32
59 0.32
60 0.3
61 0.25
62 0.19
63 0.15
64 0.1
65 0.1
66 0.09
67 0.07
68 0.07
69 0.08
70 0.09
71 0.13
72 0.14
73 0.17
74 0.17
75 0.18
76 0.23
77 0.26
78 0.25
79 0.24
80 0.25
81 0.26
82 0.28
83 0.29
84 0.26
85 0.24
86 0.26
87 0.24
88 0.23
89 0.23
90 0.26
91 0.27
92 0.29
93 0.29
94 0.28
95 0.29
96 0.29
97 0.28
98 0.24
99 0.2
100 0.19
101 0.17
102 0.15
103 0.15
104 0.14
105 0.14
106 0.2
107 0.24
108 0.25
109 0.3
110 0.3
111 0.35
112 0.44
113 0.53
114 0.55
115 0.58
116 0.61
117 0.61
118 0.65
119 0.63
120 0.57
121 0.54
122 0.46
123 0.4
124 0.33
125 0.31
126 0.27
127 0.23
128 0.18
129 0.12
130 0.15
131 0.2
132 0.27
133 0.28
134 0.32
135 0.34
136 0.38
137 0.39
138 0.36
139 0.32
140 0.28
141 0.25
142 0.21
143 0.2
144 0.15
145 0.14
146 0.14
147 0.12
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.07
154 0.07
155 0.07
156 0.08
157 0.08
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.04
165 0.07
166 0.07
167 0.09
168 0.09
169 0.12
170 0.13
171 0.13
172 0.23
173 0.21
174 0.23
175 0.23
176 0.25
177 0.24
178 0.27
179 0.3
180 0.24
181 0.26
182 0.27
183 0.28
184 0.27
185 0.26
186 0.23
187 0.22
188 0.23
189 0.22
190 0.2
191 0.18
192 0.19
193 0.2
194 0.21
195 0.19
196 0.18
197 0.15
198 0.14
199 0.13
200 0.12
201 0.13
202 0.13
203 0.19
204 0.23
205 0.29
206 0.29
207 0.31
208 0.4
209 0.46
210 0.5
211 0.49
212 0.48
213 0.46
214 0.47
215 0.48
216 0.42
217 0.39
218 0.39
219 0.33
220 0.32
221 0.29
222 0.33
223 0.32
224 0.3
225 0.32
226 0.36
227 0.4
228 0.41
229 0.42
230 0.4
231 0.42
232 0.47
233 0.47
234 0.47
235 0.51
236 0.54
237 0.61
238 0.64
239 0.7
240 0.67
241 0.63
242 0.58
243 0.56
244 0.51
245 0.44
246 0.4
247 0.33
248 0.29
249 0.26
250 0.25
251 0.24
252 0.23
253 0.19
254 0.2
255 0.17
256 0.18
257 0.23
258 0.22
259 0.22
260 0.27
261 0.28
262 0.25
263 0.32
264 0.34
265 0.29
266 0.3
267 0.27
268 0.28
269 0.31
270 0.32
271 0.26
272 0.32
273 0.38
274 0.44
275 0.53
276 0.58
277 0.65
278 0.75
279 0.82
280 0.83
281 0.87
282 0.84
283 0.83
284 0.82
285 0.82
286 0.81