Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RC14

Protein Details
Accession N1RC14    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-106EKERVKKEYEEKQKKKKEKEEKKEKEKNGDKEBasic
NLS Segment(s)
PositionSequence
64-116AKRKREKELEEEKERVKKEYEEKQKKKKEKEEKKEKEKNGDKEKDKEDKDEKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MATTFPNIYTLRKVAETAAKACDICYKSSTSVLITPDQKDFFFVCPVHLKDRYFCTPKIDEEAAKRKREKELEEEKERVKKEYEEKQKKKKEKEEKKEKEKNGDKEKDKEDKDEKKDEDKDKEDKSPPPEEEPRVFELKTAFYQQRLLKKRQAEAAKADRERASKPGYFPSVPSDAPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.31
4 0.29
5 0.3
6 0.29
7 0.28
8 0.28
9 0.31
10 0.26
11 0.24
12 0.24
13 0.24
14 0.24
15 0.26
16 0.27
17 0.21
18 0.23
19 0.23
20 0.27
21 0.27
22 0.27
23 0.29
24 0.29
25 0.27
26 0.26
27 0.25
28 0.21
29 0.22
30 0.2
31 0.19
32 0.24
33 0.27
34 0.3
35 0.33
36 0.32
37 0.3
38 0.37
39 0.41
40 0.39
41 0.38
42 0.38
43 0.37
44 0.37
45 0.4
46 0.36
47 0.31
48 0.34
49 0.43
50 0.43
51 0.47
52 0.48
53 0.45
54 0.5
55 0.53
56 0.5
57 0.49
58 0.54
59 0.56
60 0.58
61 0.59
62 0.55
63 0.55
64 0.52
65 0.44
66 0.35
67 0.31
68 0.33
69 0.39
70 0.47
71 0.52
72 0.6
73 0.69
74 0.76
75 0.81
76 0.82
77 0.83
78 0.83
79 0.83
80 0.85
81 0.86
82 0.87
83 0.9
84 0.9
85 0.84
86 0.83
87 0.81
88 0.79
89 0.78
90 0.76
91 0.7
92 0.67
93 0.7
94 0.68
95 0.6
96 0.58
97 0.57
98 0.57
99 0.59
100 0.61
101 0.57
102 0.57
103 0.64
104 0.63
105 0.61
106 0.57
107 0.58
108 0.54
109 0.58
110 0.54
111 0.52
112 0.51
113 0.5
114 0.47
115 0.48
116 0.5
117 0.48
118 0.47
119 0.46
120 0.44
121 0.41
122 0.38
123 0.32
124 0.28
125 0.26
126 0.24
127 0.26
128 0.24
129 0.22
130 0.29
131 0.32
132 0.41
133 0.44
134 0.48
135 0.49
136 0.53
137 0.56
138 0.58
139 0.6
140 0.55
141 0.58
142 0.61
143 0.63
144 0.59
145 0.59
146 0.54
147 0.51
148 0.48
149 0.45
150 0.42
151 0.37
152 0.38
153 0.42
154 0.44
155 0.42
156 0.42
157 0.42
158 0.4
159 0.36