Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1R777

Protein Details
Accession N1R777   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MRNSENPRSREERRRRSRKKEVQNEQQNGGRHydrophilic
NLS Segment(s)
PositionSequence
8-20RSREERRRRSRKK
Subcellular Location(s) mito 11, cyto 5.5, cyto_nucl 5.5, nucl 4.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MRNSENPRSREERRRRSRKKEVQNEQQNGGRLMVIAKVEVAVVVLVVDKAQARRGRGAIYARLRRGLQEGETARGTVGGSLAFDAAGSCVRCGLALVRVCVGRIGGIKASAKQAATMNERSNELLLTREMIDAEEELEERKKISRRKVTGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.92
4 0.95
5 0.94
6 0.94
7 0.94
8 0.93
9 0.93
10 0.93
11 0.87
12 0.8
13 0.74
14 0.65
15 0.55
16 0.45
17 0.34
18 0.23
19 0.19
20 0.16
21 0.12
22 0.09
23 0.08
24 0.07
25 0.07
26 0.06
27 0.06
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.06
37 0.12
38 0.14
39 0.16
40 0.19
41 0.21
42 0.22
43 0.24
44 0.27
45 0.29
46 0.35
47 0.38
48 0.36
49 0.38
50 0.36
51 0.33
52 0.33
53 0.27
54 0.19
55 0.2
56 0.2
57 0.2
58 0.2
59 0.19
60 0.16
61 0.15
62 0.14
63 0.07
64 0.07
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.05
74 0.05
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.1
82 0.12
83 0.13
84 0.14
85 0.14
86 0.15
87 0.15
88 0.14
89 0.09
90 0.09
91 0.1
92 0.09
93 0.11
94 0.12
95 0.14
96 0.16
97 0.17
98 0.15
99 0.16
100 0.18
101 0.21
102 0.25
103 0.28
104 0.29
105 0.29
106 0.31
107 0.29
108 0.27
109 0.22
110 0.18
111 0.15
112 0.12
113 0.12
114 0.12
115 0.12
116 0.11
117 0.11
118 0.12
119 0.1
120 0.1
121 0.09
122 0.08
123 0.1
124 0.12
125 0.12
126 0.12
127 0.18
128 0.25
129 0.33
130 0.43
131 0.52