Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RRT6

Protein Details
Accession N1RRT6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
118-142RAEHRDKLKRTARKNSRQHWLRDHTBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022698  OrsD  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF12013  OrsD  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences IHRQQSRPTLPPAKLQKLERLSLYYNLPEAAIICTKCGFALSPKRTSEHPGKKHGIARSARHSLKPLLSSLNLPDPDTLVPRPNGSRRHPYLPVQEGSSCKRCGLHCASWNVLADHLRAEHRDKLKRTARKNSRQHWLRDHTQQGVLFQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.63
4 0.6
5 0.61
6 0.54
7 0.49
8 0.43
9 0.39
10 0.39
11 0.31
12 0.26
13 0.23
14 0.21
15 0.16
16 0.14
17 0.13
18 0.14
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.13
25 0.11
26 0.14
27 0.25
28 0.29
29 0.35
30 0.36
31 0.38
32 0.39
33 0.44
34 0.48
35 0.47
36 0.49
37 0.51
38 0.54
39 0.57
40 0.6
41 0.58
42 0.55
43 0.5
44 0.48
45 0.47
46 0.51
47 0.48
48 0.44
49 0.43
50 0.38
51 0.35
52 0.32
53 0.26
54 0.2
55 0.19
56 0.18
57 0.17
58 0.19
59 0.17
60 0.16
61 0.15
62 0.14
63 0.13
64 0.15
65 0.14
66 0.11
67 0.12
68 0.13
69 0.16
70 0.21
71 0.27
72 0.3
73 0.38
74 0.4
75 0.45
76 0.47
77 0.49
78 0.5
79 0.49
80 0.45
81 0.38
82 0.36
83 0.34
84 0.35
85 0.35
86 0.29
87 0.24
88 0.26
89 0.25
90 0.29
91 0.33
92 0.35
93 0.37
94 0.4
95 0.42
96 0.42
97 0.42
98 0.36
99 0.31
100 0.24
101 0.19
102 0.15
103 0.15
104 0.14
105 0.15
106 0.19
107 0.25
108 0.32
109 0.4
110 0.42
111 0.51
112 0.59
113 0.65
114 0.7
115 0.74
116 0.77
117 0.79
118 0.86
119 0.84
120 0.86
121 0.85
122 0.84
123 0.82
124 0.8
125 0.76
126 0.75
127 0.73
128 0.66
129 0.64
130 0.57