Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RIY3

Protein Details
Accession N1RIY3   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
281-301GKSLRKKTSRFRIKDLPFFRRBasic
NLS Segment(s)
PositionSequence
282-292KSLRKKTSRFR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036971  PDEase_catalytic_dom_sf  
Gene Ontology GO:0004114  F:3',5'-cyclic-nucleotide phosphodiesterase activity  
GO:0007165  P:signal transduction  
Amino Acid Sequences MTPPKQDMTSLAKGQLGFMNLFATPLFQGVADIMPAMQYTVDELEMNKSLFELKLQQEKEKQPLDDPIRRRLLKEGTFSPRTMSFAVPQEEEKEEKRDMTTLFEALDRGSDTTPVGNGELPMPRPERDDLSPADSQRTMGPSAANGVVGDHRGSNGSASTFDAVRELANSDPFQTQTRRDSAKQRSSETTDGSVSGACSGDWASQATSATTGKMPMSPSTRGTSIVSGDSTEHAVGIPKINVDSASLKDSSGTLRQDGSPIDDETRSDASTTGGSIGRAEGKSLRKKTSRFRIKDLPFFRRHKGTNSPSTADMTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.27
4 0.2
5 0.17
6 0.17
7 0.14
8 0.14
9 0.12
10 0.11
11 0.09
12 0.09
13 0.08
14 0.07
15 0.07
16 0.08
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.04
26 0.06
27 0.07
28 0.08
29 0.08
30 0.09
31 0.12
32 0.14
33 0.15
34 0.13
35 0.12
36 0.13
37 0.13
38 0.14
39 0.17
40 0.2
41 0.28
42 0.31
43 0.37
44 0.43
45 0.48
46 0.54
47 0.53
48 0.49
49 0.43
50 0.51
51 0.53
52 0.53
53 0.52
54 0.53
55 0.57
56 0.57
57 0.55
58 0.53
59 0.53
60 0.5
61 0.52
62 0.5
63 0.49
64 0.51
65 0.5
66 0.46
67 0.38
68 0.36
69 0.32
70 0.25
71 0.21
72 0.24
73 0.26
74 0.24
75 0.24
76 0.24
77 0.25
78 0.26
79 0.24
80 0.23
81 0.21
82 0.21
83 0.21
84 0.21
85 0.2
86 0.22
87 0.21
88 0.18
89 0.17
90 0.16
91 0.16
92 0.13
93 0.13
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.09
106 0.1
107 0.11
108 0.14
109 0.15
110 0.15
111 0.18
112 0.19
113 0.21
114 0.2
115 0.23
116 0.21
117 0.24
118 0.26
119 0.23
120 0.24
121 0.21
122 0.19
123 0.17
124 0.18
125 0.14
126 0.12
127 0.11
128 0.09
129 0.11
130 0.1
131 0.09
132 0.07
133 0.07
134 0.06
135 0.07
136 0.07
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.07
148 0.06
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.08
156 0.08
157 0.09
158 0.1
159 0.11
160 0.13
161 0.14
162 0.17
163 0.19
164 0.24
165 0.26
166 0.28
167 0.37
168 0.44
169 0.51
170 0.51
171 0.51
172 0.51
173 0.52
174 0.51
175 0.44
176 0.36
177 0.28
178 0.24
179 0.21
180 0.17
181 0.12
182 0.1
183 0.08
184 0.06
185 0.06
186 0.06
187 0.06
188 0.07
189 0.07
190 0.07
191 0.08
192 0.08
193 0.08
194 0.09
195 0.09
196 0.09
197 0.09
198 0.1
199 0.09
200 0.11
201 0.12
202 0.15
203 0.19
204 0.2
205 0.22
206 0.24
207 0.25
208 0.25
209 0.25
210 0.22
211 0.19
212 0.18
213 0.16
214 0.13
215 0.13
216 0.12
217 0.12
218 0.1
219 0.09
220 0.08
221 0.09
222 0.09
223 0.11
224 0.11
225 0.1
226 0.1
227 0.11
228 0.11
229 0.12
230 0.13
231 0.13
232 0.15
233 0.15
234 0.15
235 0.15
236 0.15
237 0.16
238 0.19
239 0.19
240 0.17
241 0.19
242 0.19
243 0.21
244 0.21
245 0.22
246 0.2
247 0.2
248 0.21
249 0.2
250 0.2
251 0.22
252 0.23
253 0.19
254 0.16
255 0.15
256 0.14
257 0.14
258 0.14
259 0.12
260 0.11
261 0.11
262 0.11
263 0.13
264 0.17
265 0.16
266 0.18
267 0.21
268 0.29
269 0.39
270 0.44
271 0.52
272 0.54
273 0.61
274 0.7
275 0.75
276 0.77
277 0.74
278 0.77
279 0.79
280 0.8
281 0.83
282 0.81
283 0.8
284 0.78
285 0.77
286 0.76
287 0.74
288 0.69
289 0.67
290 0.68
291 0.68
292 0.69
293 0.7
294 0.66
295 0.59