Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RPT4

Protein Details
Accession N1RPT4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-73DRLDAKRAKYQKKLEKKRQGEAENBasic
NLS Segment(s)
PositionSequence
53-67DAKRAKYQKKLEKKR
Subcellular Location(s) mito 12.5, cyto_mito 10.5, cyto 7.5, nucl 3, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYAAMTPQWAGTLLGLLEVAMIPIPFVFWRYGAKIRAKSPAIRALREEQDRLDAKRAKYQKKLEKKRQGEAENAKTEEVGVLEKAAGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.05
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.06
14 0.06
15 0.07
16 0.09
17 0.13
18 0.18
19 0.23
20 0.29
21 0.32
22 0.34
23 0.4
24 0.4
25 0.39
26 0.38
27 0.42
28 0.38
29 0.34
30 0.35
31 0.32
32 0.36
33 0.35
34 0.32
35 0.23
36 0.27
37 0.28
38 0.27
39 0.31
40 0.3
41 0.29
42 0.37
43 0.44
44 0.46
45 0.52
46 0.61
47 0.63
48 0.7
49 0.8
50 0.83
51 0.86
52 0.85
53 0.84
54 0.84
55 0.77
56 0.76
57 0.74
58 0.72
59 0.67
60 0.62
61 0.53
62 0.44
63 0.4
64 0.31
65 0.22
66 0.15
67 0.09
68 0.09