Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1R6N1

Protein Details
Accession N1R6N1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-69IPKEIREKKKEEKPKPLNRKEAKQLBasic
NLS Segment(s)
PositionSequence
47-76KEIREKKKEEKPKPLNRKEAKQLAAKERQR
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR039146  GPANK1  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MGLKALKSQGWDPDARRGLGREGEGMRYPIKVVAKEDTLGIGATIPKEIREKKKEEKPKPLNRKEAKQLAAKERQRHERLQGEIYGRVDVESYLRGKGDDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.39
4 0.35
5 0.34
6 0.33
7 0.31
8 0.26
9 0.24
10 0.26
11 0.26
12 0.26
13 0.22
14 0.19
15 0.19
16 0.17
17 0.18
18 0.17
19 0.18
20 0.19
21 0.19
22 0.19
23 0.19
24 0.15
25 0.13
26 0.11
27 0.09
28 0.06
29 0.06
30 0.05
31 0.06
32 0.06
33 0.07
34 0.12
35 0.17
36 0.25
37 0.3
38 0.36
39 0.44
40 0.53
41 0.63
42 0.66
43 0.72
44 0.75
45 0.8
46 0.85
47 0.85
48 0.86
49 0.82
50 0.81
51 0.79
52 0.76
53 0.69
54 0.65
55 0.63
56 0.6
57 0.64
58 0.63
59 0.62
60 0.62
61 0.67
62 0.65
63 0.63
64 0.63
65 0.6
66 0.58
67 0.54
68 0.51
69 0.44
70 0.43
71 0.4
72 0.33
73 0.26
74 0.22
75 0.18
76 0.14
77 0.13
78 0.13
79 0.13
80 0.14
81 0.14