Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RJY8

Protein Details
Accession N1RJY8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-63AGRLSRIRKTKNKVKERRASEFRRBasic
NLS Segment(s)
PositionSequence
43-59LSRIRKTKNKVKERRAS
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 6.5, mito 3
Family & Domain DBs
Amino Acid Sequences VKKLISQEKKLDKDEEEAGEDLLKLHEELATLQARMAVAAGRLSRIRKTKNKVKERRASEFRRGIQGLEGEDKLAEELSRRENEASEELQSLNPEGIDWDSLGLGDFNFDPLSSDVVGESSSGVVGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.44
3 0.37
4 0.31
5 0.27
6 0.23
7 0.21
8 0.17
9 0.12
10 0.1
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.12
17 0.13
18 0.12
19 0.12
20 0.13
21 0.12
22 0.11
23 0.11
24 0.07
25 0.06
26 0.08
27 0.08
28 0.09
29 0.11
30 0.13
31 0.18
32 0.24
33 0.32
34 0.38
35 0.47
36 0.55
37 0.63
38 0.72
39 0.77
40 0.81
41 0.82
42 0.8
43 0.81
44 0.81
45 0.76
46 0.74
47 0.71
48 0.62
49 0.59
50 0.52
51 0.43
52 0.35
53 0.3
54 0.22
55 0.17
56 0.16
57 0.11
58 0.1
59 0.1
60 0.08
61 0.07
62 0.06
63 0.05
64 0.07
65 0.11
66 0.12
67 0.13
68 0.14
69 0.14
70 0.17
71 0.19
72 0.18
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.13
79 0.1
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.07
95 0.07
96 0.07
97 0.09
98 0.1
99 0.12
100 0.11
101 0.11
102 0.1
103 0.1
104 0.11
105 0.08
106 0.08
107 0.06