Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1SAX0

Protein Details
Accession N1SAX0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
246-266KETPFKWPSNHWPKEKRFKILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 11, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MATIGADPVIHIDVDDDRDSAVGDDNTSSTASVTSSILNYRFENGRTYHGYKDGKYYMPNDETENDRLDLQHNLFLLTFDNKLGLSPPNLPDFKTGRVLDLGTGTGIWAIDFADEHPEAEVIGVDLSPTQPEFVPPNLQFEIDDIDDEWTYSLPFDYIHSRMMNVSVKNWPEYLRKIFENLAPGGYAELQDVDIMMQSDDNTLTQDHALWKWGFFLAKAGQEHGTPFIETNRLKHIMTEIGFVDVKETPFKWPSNHWPKEKRFKILGEWSNQNTVNLLNGLSMALFTRCLGWTPEEVNVFLVDVRKDLNNPKIHAYWSMYFLPPLFFSVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.13
5 0.13
6 0.14
7 0.13
8 0.15
9 0.11
10 0.11
11 0.12
12 0.12
13 0.13
14 0.13
15 0.13
16 0.09
17 0.09
18 0.08
19 0.09
20 0.09
21 0.1
22 0.11
23 0.15
24 0.16
25 0.18
26 0.19
27 0.21
28 0.24
29 0.24
30 0.27
31 0.25
32 0.29
33 0.34
34 0.36
35 0.36
36 0.41
37 0.44
38 0.4
39 0.46
40 0.44
41 0.39
42 0.4
43 0.4
44 0.39
45 0.38
46 0.38
47 0.33
48 0.32
49 0.33
50 0.32
51 0.32
52 0.25
53 0.22
54 0.22
55 0.2
56 0.23
57 0.2
58 0.2
59 0.17
60 0.17
61 0.17
62 0.16
63 0.16
64 0.14
65 0.13
66 0.1
67 0.11
68 0.1
69 0.1
70 0.11
71 0.11
72 0.12
73 0.15
74 0.18
75 0.24
76 0.24
77 0.25
78 0.29
79 0.29
80 0.3
81 0.33
82 0.31
83 0.26
84 0.27
85 0.26
86 0.21
87 0.19
88 0.16
89 0.09
90 0.09
91 0.07
92 0.06
93 0.05
94 0.04
95 0.04
96 0.03
97 0.03
98 0.04
99 0.04
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.09
120 0.1
121 0.16
122 0.16
123 0.21
124 0.21
125 0.21
126 0.19
127 0.18
128 0.19
129 0.12
130 0.12
131 0.08
132 0.09
133 0.08
134 0.08
135 0.08
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.08
144 0.09
145 0.12
146 0.12
147 0.12
148 0.12
149 0.15
150 0.17
151 0.15
152 0.15
153 0.17
154 0.18
155 0.18
156 0.19
157 0.19
158 0.18
159 0.22
160 0.25
161 0.24
162 0.23
163 0.24
164 0.25
165 0.24
166 0.24
167 0.2
168 0.17
169 0.14
170 0.13
171 0.11
172 0.1
173 0.09
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.05
187 0.05
188 0.06
189 0.05
190 0.06
191 0.06
192 0.08
193 0.09
194 0.09
195 0.13
196 0.12
197 0.12
198 0.13
199 0.14
200 0.13
201 0.11
202 0.14
203 0.13
204 0.17
205 0.17
206 0.18
207 0.18
208 0.18
209 0.19
210 0.17
211 0.16
212 0.12
213 0.12
214 0.12
215 0.18
216 0.18
217 0.19
218 0.23
219 0.25
220 0.24
221 0.24
222 0.25
223 0.23
224 0.24
225 0.24
226 0.18
227 0.18
228 0.18
229 0.18
230 0.17
231 0.14
232 0.14
233 0.14
234 0.15
235 0.16
236 0.21
237 0.23
238 0.24
239 0.28
240 0.39
241 0.47
242 0.55
243 0.6
244 0.66
245 0.73
246 0.82
247 0.82
248 0.78
249 0.73
250 0.68
251 0.67
252 0.67
253 0.64
254 0.59
255 0.59
256 0.54
257 0.54
258 0.51
259 0.43
260 0.33
261 0.27
262 0.22
263 0.16
264 0.14
265 0.09
266 0.08
267 0.08
268 0.07
269 0.07
270 0.06
271 0.06
272 0.06
273 0.06
274 0.08
275 0.09
276 0.1
277 0.13
278 0.15
279 0.18
280 0.19
281 0.24
282 0.23
283 0.24
284 0.23
285 0.21
286 0.18
287 0.16
288 0.17
289 0.13
290 0.12
291 0.14
292 0.14
293 0.19
294 0.26
295 0.33
296 0.37
297 0.39
298 0.44
299 0.45
300 0.45
301 0.46
302 0.45
303 0.39
304 0.37
305 0.38
306 0.33
307 0.32
308 0.31
309 0.28
310 0.22