Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RSI3

Protein Details
Accession N1RSI3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-124AATTPKDGKKRGRKPKAADVSEHydrophilic
NLS Segment(s)
PositionSequence
33-118PVKRGRGRPPKGAAPMPKKVYVPTGRPRGRPPGSGKKTTAGPKKVAAVNDDGTPKQGRGRPRRAASGTESAATTPKDGKKRGRKPK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MARTKEDVASKGDASPRIPKSSAGVTKNTAEAPVKRGRGRPPKGAAPMPKKVYVPTGRPRGRPPGSGKKTTAGPKKVAAVNDDGTPKQGRGRPRRAASGTESAATTPKDGKKRGRKPKAADVSEDEETKHDEPADEDDAGNESPAKDEAHDEDGEASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.37
4 0.38
5 0.38
6 0.35
7 0.35
8 0.42
9 0.46
10 0.41
11 0.4
12 0.38
13 0.39
14 0.4
15 0.36
16 0.3
17 0.26
18 0.24
19 0.26
20 0.3
21 0.34
22 0.36
23 0.41
24 0.48
25 0.55
26 0.59
27 0.62
28 0.61
29 0.62
30 0.65
31 0.66
32 0.65
33 0.62
34 0.64
35 0.58
36 0.55
37 0.49
38 0.44
39 0.45
40 0.41
41 0.41
42 0.42
43 0.49
44 0.5
45 0.53
46 0.56
47 0.57
48 0.55
49 0.54
50 0.54
51 0.54
52 0.56
53 0.58
54 0.55
55 0.48
56 0.5
57 0.52
58 0.51
59 0.44
60 0.4
61 0.37
62 0.39
63 0.39
64 0.35
65 0.28
66 0.23
67 0.2
68 0.2
69 0.2
70 0.16
71 0.16
72 0.16
73 0.14
74 0.16
75 0.18
76 0.25
77 0.33
78 0.43
79 0.49
80 0.52
81 0.59
82 0.56
83 0.56
84 0.52
85 0.49
86 0.4
87 0.33
88 0.3
89 0.23
90 0.22
91 0.19
92 0.16
93 0.15
94 0.2
95 0.25
96 0.31
97 0.41
98 0.5
99 0.6
100 0.7
101 0.76
102 0.79
103 0.81
104 0.86
105 0.86
106 0.78
107 0.71
108 0.66
109 0.61
110 0.54
111 0.47
112 0.37
113 0.27
114 0.29
115 0.25
116 0.21
117 0.16
118 0.14
119 0.15
120 0.19
121 0.22
122 0.18
123 0.17
124 0.16
125 0.18
126 0.18
127 0.17
128 0.13
129 0.09
130 0.1
131 0.12
132 0.12
133 0.11
134 0.14
135 0.17
136 0.2
137 0.2
138 0.19