Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1SAG6

Protein Details
Accession N1SAG6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-38RLRTQTGCLKCRKRRKKCDEVKPQCKGCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MASPIQSKARLRTQTGCLKCRKRRKKCDEVKPQCKGCIRNGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.59
4 0.59
5 0.64
6 0.69
7 0.75
8 0.78
9 0.79
10 0.84
11 0.88
12 0.9
13 0.9
14 0.92
15 0.93
16 0.93
17 0.92
18 0.9
19 0.84
20 0.8
21 0.76
22 0.69
23 0.65