Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RAD4

Protein Details
Accession N1RAD4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
216-235QGKLRKPKDSDDKEDKRQRRBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020993  Centromere_CenpK  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0051382  P:kinetochore assembly  
Amino Acid Sequences MDYRSQPTAKEEYTANVDQTLRELQERVQQHENELEKLRSEQSQPPESAAGQARLIQVALKEVTESDPFLPSPGSLLPTLLAFRKTHQTIQESKSYLASQRVSHEQLSRQLEADEARLKDQKLLGDALTARILSLRDEVDAGTHVTPGEGAEELLQELRAKKKSYDRETSKLMKVLLRFIDNHLAPMLAAEELGGPVVGDLIGIDGDDLAAGFNAQGKLRKPKDSDDKEDKRQRRIDEIWGQATNGGTGRQDEIAAAAAEMKQLTEELLNTLAEAQGNNSASYVQLSRESAAARFLVRSKVAQFHPRDATRLRLVDFGRDLEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.27
4 0.27
5 0.25
6 0.26
7 0.26
8 0.21
9 0.2
10 0.21
11 0.2
12 0.27
13 0.31
14 0.33
15 0.38
16 0.36
17 0.37
18 0.44
19 0.44
20 0.41
21 0.42
22 0.37
23 0.31
24 0.33
25 0.32
26 0.28
27 0.3
28 0.33
29 0.36
30 0.41
31 0.4
32 0.4
33 0.4
34 0.36
35 0.37
36 0.34
37 0.28
38 0.22
39 0.24
40 0.23
41 0.21
42 0.2
43 0.16
44 0.13
45 0.14
46 0.14
47 0.1
48 0.1
49 0.1
50 0.13
51 0.13
52 0.14
53 0.12
54 0.13
55 0.13
56 0.14
57 0.14
58 0.11
59 0.12
60 0.11
61 0.12
62 0.1
63 0.11
64 0.1
65 0.11
66 0.12
67 0.12
68 0.14
69 0.12
70 0.14
71 0.22
72 0.25
73 0.28
74 0.32
75 0.35
76 0.4
77 0.43
78 0.48
79 0.42
80 0.4
81 0.38
82 0.34
83 0.31
84 0.29
85 0.28
86 0.23
87 0.24
88 0.29
89 0.29
90 0.3
91 0.31
92 0.29
93 0.34
94 0.36
95 0.33
96 0.29
97 0.26
98 0.25
99 0.22
100 0.22
101 0.2
102 0.16
103 0.18
104 0.2
105 0.2
106 0.22
107 0.23
108 0.21
109 0.18
110 0.18
111 0.15
112 0.15
113 0.15
114 0.13
115 0.12
116 0.11
117 0.09
118 0.08
119 0.09
120 0.07
121 0.09
122 0.08
123 0.07
124 0.08
125 0.08
126 0.07
127 0.08
128 0.08
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.07
145 0.11
146 0.14
147 0.15
148 0.18
149 0.26
150 0.35
151 0.42
152 0.5
153 0.52
154 0.53
155 0.58
156 0.61
157 0.55
158 0.48
159 0.42
160 0.34
161 0.29
162 0.28
163 0.24
164 0.2
165 0.19
166 0.19
167 0.24
168 0.21
169 0.21
170 0.17
171 0.15
172 0.13
173 0.12
174 0.11
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.04
181 0.03
182 0.02
183 0.02
184 0.03
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.05
201 0.06
202 0.08
203 0.11
204 0.15
205 0.25
206 0.29
207 0.36
208 0.36
209 0.44
210 0.54
211 0.59
212 0.65
213 0.66
214 0.69
215 0.73
216 0.8
217 0.77
218 0.75
219 0.74
220 0.67
221 0.65
222 0.61
223 0.6
224 0.58
225 0.57
226 0.53
227 0.47
228 0.44
229 0.37
230 0.33
231 0.25
232 0.17
233 0.13
234 0.09
235 0.09
236 0.11
237 0.1
238 0.1
239 0.09
240 0.09
241 0.1
242 0.09
243 0.08
244 0.07
245 0.07
246 0.08
247 0.08
248 0.07
249 0.05
250 0.05
251 0.06
252 0.06
253 0.07
254 0.07
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.09
261 0.08
262 0.08
263 0.12
264 0.13
265 0.13
266 0.13
267 0.12
268 0.12
269 0.14
270 0.14
271 0.11
272 0.13
273 0.15
274 0.15
275 0.17
276 0.18
277 0.17
278 0.18
279 0.18
280 0.16
281 0.17
282 0.19
283 0.22
284 0.22
285 0.25
286 0.26
287 0.32
288 0.37
289 0.44
290 0.46
291 0.49
292 0.56
293 0.55
294 0.57
295 0.52
296 0.53
297 0.52
298 0.51
299 0.45
300 0.43
301 0.41
302 0.43
303 0.43