Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1S175

Protein Details
Accession N1S175    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
120-139TPPGRGMPKLSTRRRRHPHEBasic
NLS Segment(s)
PositionSequence
132-136RRRRH
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, cyto 7, cyto_mito 5.333, mito 2.5
Family & Domain DBs
Amino Acid Sequences MWDAFAALCDLGVTVRVPNVFKPSDTLVHSFDAETSPLISREGPVPIIPDIPMKKSQRNATMDVASDPFSSSHSPTIHELTNGDSGQEMDKSEFMQKIQEGRMRYATSTNSSSGFDGMETPPGRGMPKLSTRRRRHPHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.09
3 0.11
4 0.12
5 0.14
6 0.2
7 0.21
8 0.2
9 0.23
10 0.25
11 0.27
12 0.29
13 0.3
14 0.26
15 0.27
16 0.27
17 0.23
18 0.2
19 0.17
20 0.14
21 0.11
22 0.1
23 0.09
24 0.09
25 0.1
26 0.1
27 0.09
28 0.11
29 0.12
30 0.11
31 0.1
32 0.12
33 0.11
34 0.12
35 0.12
36 0.15
37 0.15
38 0.17
39 0.24
40 0.25
41 0.29
42 0.34
43 0.39
44 0.42
45 0.45
46 0.45
47 0.41
48 0.39
49 0.35
50 0.31
51 0.27
52 0.19
53 0.16
54 0.12
55 0.09
56 0.09
57 0.1
58 0.1
59 0.13
60 0.12
61 0.14
62 0.15
63 0.17
64 0.16
65 0.16
66 0.15
67 0.14
68 0.17
69 0.15
70 0.13
71 0.11
72 0.11
73 0.11
74 0.12
75 0.1
76 0.07
77 0.07
78 0.09
79 0.11
80 0.12
81 0.11
82 0.14
83 0.15
84 0.18
85 0.22
86 0.25
87 0.24
88 0.26
89 0.31
90 0.29
91 0.29
92 0.28
93 0.26
94 0.27
95 0.27
96 0.26
97 0.22
98 0.23
99 0.22
100 0.19
101 0.17
102 0.12
103 0.12
104 0.12
105 0.18
106 0.17
107 0.17
108 0.18
109 0.19
110 0.2
111 0.18
112 0.21
113 0.21
114 0.31
115 0.41
116 0.5
117 0.6
118 0.68
119 0.78