Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DGI3

Protein Details
Accession B0DGI3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-43IKKHKNYKKDFGKEYPRGRKABasic
NLS Segment(s)
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
Gene Ontology GO:0016020  C:membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0006629  P:lipid metabolic process  
KEGG lbc:LACBIDRAFT_300331  -  
Pfam View protein in Pfam  
PF02544  Steroid_dh  
Amino Acid Sequences MTGSVAALVFTGLAVGQMALWAIKKHKNYKKDFGKEYPRGRKAMFPFVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.08
10 0.13
11 0.18
12 0.28
13 0.35
14 0.44
15 0.51
16 0.6
17 0.68
18 0.72
19 0.74
20 0.73
21 0.77
22 0.77
23 0.81
24 0.81
25 0.75
26 0.71
27 0.66
28 0.65
29 0.6