Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RPX1

Protein Details
Accession N1RPX1   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-99FVVVCCCRRPKQPKKRRSYRSSYADSHydrophilic
NLS Segment(s)
PositionSequence
83-90PKQPKKRR
Subcellular Location(s) plas 12, mito 4, cyto 4, cyto_mito 4, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGVPHINARQEVQVITQTVYLPTTTYTTQVTLGVASAPATDRPVVTSQHSGDGLSSAQIGAIIGSIVGVFVLAFVVVCCCRRPKQPKKRRSYRSSYADSSDGWSERMPYEGWTRPVPIPVARPVPVQFPSPVVQREQIPGGPKFPTYRAIPIPNPRKGENPPRTYWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.18
5 0.17
6 0.17
7 0.15
8 0.11
9 0.11
10 0.13
11 0.12
12 0.13
13 0.14
14 0.14
15 0.15
16 0.15
17 0.14
18 0.11
19 0.1
20 0.09
21 0.08
22 0.07
23 0.06
24 0.07
25 0.07
26 0.08
27 0.09
28 0.08
29 0.11
30 0.13
31 0.14
32 0.17
33 0.2
34 0.2
35 0.22
36 0.22
37 0.2
38 0.17
39 0.16
40 0.13
41 0.09
42 0.08
43 0.05
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.03
63 0.04
64 0.05
65 0.06
66 0.09
67 0.12
68 0.21
69 0.32
70 0.42
71 0.53
72 0.63
73 0.73
74 0.81
75 0.89
76 0.9
77 0.88
78 0.85
79 0.84
80 0.81
81 0.77
82 0.68
83 0.6
84 0.51
85 0.43
86 0.36
87 0.28
88 0.21
89 0.16
90 0.13
91 0.12
92 0.11
93 0.12
94 0.1
95 0.11
96 0.16
97 0.19
98 0.22
99 0.22
100 0.25
101 0.24
102 0.26
103 0.26
104 0.22
105 0.22
106 0.24
107 0.27
108 0.25
109 0.27
110 0.26
111 0.28
112 0.28
113 0.26
114 0.22
115 0.21
116 0.23
117 0.25
118 0.25
119 0.23
120 0.24
121 0.24
122 0.26
123 0.26
124 0.26
125 0.27
126 0.27
127 0.27
128 0.25
129 0.26
130 0.26
131 0.25
132 0.28
133 0.26
134 0.31
135 0.36
136 0.41
137 0.46
138 0.54
139 0.61
140 0.63
141 0.64
142 0.6
143 0.6
144 0.62
145 0.66
146 0.66
147 0.64