Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RZS3

Protein Details
Accession N1RZS3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-68PAYALARKIKEKKHKRDEAKAAEKKLBasic
NLS Segment(s)
PositionSequence
49-67RKIKEKKHKRDEAKAAEKK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MSNFRPHPLPFTSKDPRMNDATGEGEAAISDPCLFPCYIASEPAYALARKIKEKKHKRDEAKAAEKKLDDEESTKAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.55
4 0.54
5 0.5
6 0.42
7 0.36
8 0.31
9 0.23
10 0.19
11 0.15
12 0.1
13 0.09
14 0.08
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.06
21 0.06
22 0.06
23 0.06
24 0.1
25 0.1
26 0.11
27 0.12
28 0.11
29 0.11
30 0.13
31 0.13
32 0.09
33 0.1
34 0.13
35 0.15
36 0.21
37 0.28
38 0.35
39 0.45
40 0.56
41 0.66
42 0.73
43 0.81
44 0.83
45 0.87
46 0.88
47 0.88
48 0.88
49 0.84
50 0.77
51 0.72
52 0.64
53 0.56
54 0.5
55 0.43
56 0.34
57 0.3
58 0.32