Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RSZ3

Protein Details
Accession N1RSZ3    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
84-103GSAKKRATPRKAKKEESDDDBasic
107-126KPKTPASKNKVKKEEEKDSTBasic
NLS Segment(s)
PositionSequence
74-98PKRKAKAEGAGSAKKRATPRKAKKE
113-116SKNK
Subcellular Location(s) nucl 19, cyto 8
Family & Domain DBs
Amino Acid Sequences MSKQEPADQVKFLVSCIGHTTNGRPDFQAVAEELSIVSKAAAQKRYERMLKAHGISRPGALANGNGTDSAPSTPKRKAKAEGAGSAKKRATPRKAKKEESDDDEDAKPKTPASKNKVKKEEEKDSTDSTGSLSDAPPSDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.2
4 0.21
5 0.2
6 0.21
7 0.25
8 0.29
9 0.32
10 0.32
11 0.28
12 0.27
13 0.26
14 0.26
15 0.23
16 0.15
17 0.14
18 0.12
19 0.12
20 0.1
21 0.09
22 0.08
23 0.06
24 0.05
25 0.06
26 0.1
27 0.16
28 0.21
29 0.22
30 0.29
31 0.34
32 0.41
33 0.42
34 0.41
35 0.38
36 0.39
37 0.42
38 0.38
39 0.37
40 0.32
41 0.31
42 0.29
43 0.26
44 0.21
45 0.16
46 0.15
47 0.11
48 0.09
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.12
60 0.18
61 0.23
62 0.27
63 0.3
64 0.33
65 0.38
66 0.45
67 0.46
68 0.46
69 0.48
70 0.5
71 0.47
72 0.47
73 0.41
74 0.37
75 0.39
76 0.42
77 0.45
78 0.5
79 0.6
80 0.68
81 0.76
82 0.79
83 0.8
84 0.8
85 0.77
86 0.72
87 0.69
88 0.6
89 0.54
90 0.5
91 0.44
92 0.36
93 0.31
94 0.25
95 0.18
96 0.24
97 0.29
98 0.37
99 0.43
100 0.53
101 0.61
102 0.71
103 0.79
104 0.77
105 0.8
106 0.79
107 0.82
108 0.78
109 0.75
110 0.69
111 0.63
112 0.59
113 0.5
114 0.4
115 0.3
116 0.25
117 0.19
118 0.16
119 0.12
120 0.13
121 0.14