Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1R9A7

Protein Details
Accession N1R9A7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
121-142IEQTRQRKISGRRQREKAQFNEHydrophilic
369-389SNTGRCKVKGCKLPHRERASVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto_mito 5.499, cyto 5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MSEEERELLARISQVAGQINRHKNQQAGSRGSPSHHPAHHRQNSYRHASSPYPTRHNRIGRHPTAHHHRTLHLNGDNSTASRSASSGAETPPGWVSRTDRHRQLINANVYEKETQNRAKAIEQTRQRKISGRRQREKAQFNEFLKHQATASSAQTNPADRNVLTIEGAQFRVMDGGKKLVKIPDALNSSSRTPKFATVAGVKFYRTKTGNLVANRFVNDQRRTGAVKKINQPCKIFSTTGWSATHLLYLDRPSGHGAKLTSTLHIGSCTKGPRCRYIHDPNKVALCKDILKDGQCVNGESCDLSHDMTPERTPNCLHYAKGHCAKADCPYTHSKASPAAPVCRNFGFNGYCEMGAECTDRHVFECPDFSNTGRCKVKGCKLPHRERASVLRNKTNAAGEPLGDISSDDEAADSDDVDSDEVAEFIDADSDLSDFEEQKDFLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.22
3 0.23
4 0.29
5 0.38
6 0.45
7 0.47
8 0.52
9 0.52
10 0.5
11 0.54
12 0.55
13 0.55
14 0.54
15 0.55
16 0.55
17 0.54
18 0.52
19 0.53
20 0.49
21 0.48
22 0.46
23 0.49
24 0.51
25 0.61
26 0.67
27 0.69
28 0.7
29 0.72
30 0.76
31 0.77
32 0.71
33 0.63
34 0.59
35 0.55
36 0.54
37 0.54
38 0.53
39 0.54
40 0.56
41 0.6
42 0.63
43 0.68
44 0.69
45 0.7
46 0.73
47 0.71
48 0.73
49 0.7
50 0.71
51 0.73
52 0.71
53 0.67
54 0.59
55 0.55
56 0.56
57 0.56
58 0.54
59 0.48
60 0.45
61 0.39
62 0.4
63 0.37
64 0.29
65 0.27
66 0.2
67 0.15
68 0.13
69 0.13
70 0.11
71 0.11
72 0.13
73 0.14
74 0.14
75 0.17
76 0.16
77 0.17
78 0.18
79 0.19
80 0.18
81 0.17
82 0.2
83 0.26
84 0.35
85 0.41
86 0.45
87 0.48
88 0.51
89 0.52
90 0.55
91 0.55
92 0.53
93 0.49
94 0.44
95 0.41
96 0.39
97 0.38
98 0.33
99 0.27
100 0.26
101 0.27
102 0.29
103 0.3
104 0.3
105 0.31
106 0.38
107 0.4
108 0.42
109 0.47
110 0.52
111 0.58
112 0.59
113 0.57
114 0.57
115 0.61
116 0.64
117 0.65
118 0.68
119 0.7
120 0.74
121 0.82
122 0.83
123 0.82
124 0.78
125 0.75
126 0.73
127 0.66
128 0.63
129 0.54
130 0.5
131 0.42
132 0.36
133 0.28
134 0.2
135 0.2
136 0.18
137 0.2
138 0.19
139 0.18
140 0.19
141 0.21
142 0.21
143 0.2
144 0.19
145 0.19
146 0.14
147 0.16
148 0.14
149 0.14
150 0.12
151 0.12
152 0.12
153 0.12
154 0.12
155 0.11
156 0.1
157 0.09
158 0.1
159 0.1
160 0.1
161 0.09
162 0.14
163 0.15
164 0.16
165 0.17
166 0.17
167 0.18
168 0.19
169 0.19
170 0.21
171 0.23
172 0.23
173 0.24
174 0.24
175 0.25
176 0.29
177 0.29
178 0.24
179 0.22
180 0.23
181 0.23
182 0.22
183 0.23
184 0.22
185 0.23
186 0.23
187 0.22
188 0.21
189 0.22
190 0.22
191 0.23
192 0.2
193 0.2
194 0.21
195 0.26
196 0.31
197 0.3
198 0.33
199 0.3
200 0.3
201 0.29
202 0.27
203 0.25
204 0.27
205 0.26
206 0.24
207 0.23
208 0.24
209 0.26
210 0.27
211 0.31
212 0.3
213 0.34
214 0.42
215 0.5
216 0.55
217 0.58
218 0.57
219 0.52
220 0.51
221 0.48
222 0.4
223 0.31
224 0.31
225 0.27
226 0.29
227 0.26
228 0.23
229 0.21
230 0.2
231 0.21
232 0.13
233 0.12
234 0.1
235 0.11
236 0.11
237 0.1
238 0.1
239 0.12
240 0.13
241 0.13
242 0.14
243 0.13
244 0.12
245 0.16
246 0.16
247 0.14
248 0.14
249 0.14
250 0.12
251 0.14
252 0.13
253 0.1
254 0.13
255 0.17
256 0.21
257 0.25
258 0.27
259 0.34
260 0.37
261 0.4
262 0.45
263 0.52
264 0.57
265 0.6
266 0.6
267 0.55
268 0.58
269 0.55
270 0.46
271 0.37
272 0.3
273 0.25
274 0.23
275 0.24
276 0.2
277 0.21
278 0.23
279 0.23
280 0.25
281 0.23
282 0.23
283 0.2
284 0.18
285 0.17
286 0.14
287 0.13
288 0.1
289 0.09
290 0.09
291 0.09
292 0.1
293 0.11
294 0.13
295 0.14
296 0.18
297 0.18
298 0.19
299 0.19
300 0.21
301 0.26
302 0.26
303 0.26
304 0.29
305 0.34
306 0.41
307 0.47
308 0.45
309 0.4
310 0.4
311 0.41
312 0.4
313 0.41
314 0.34
315 0.31
316 0.36
317 0.39
318 0.41
319 0.4
320 0.35
321 0.33
322 0.34
323 0.37
324 0.34
325 0.37
326 0.38
327 0.4
328 0.41
329 0.38
330 0.37
331 0.31
332 0.32
333 0.26
334 0.22
335 0.25
336 0.22
337 0.21
338 0.2
339 0.19
340 0.15
341 0.14
342 0.15
343 0.1
344 0.12
345 0.14
346 0.14
347 0.14
348 0.18
349 0.19
350 0.19
351 0.24
352 0.22
353 0.24
354 0.25
355 0.25
356 0.29
357 0.3
358 0.37
359 0.37
360 0.37
361 0.39
362 0.46
363 0.54
364 0.54
365 0.61
366 0.63
367 0.69
368 0.79
369 0.83
370 0.82
371 0.77
372 0.73
373 0.74
374 0.73
375 0.71
376 0.68
377 0.66
378 0.6
379 0.59
380 0.57
381 0.5
382 0.43
383 0.4
384 0.34
385 0.26
386 0.26
387 0.25
388 0.21
389 0.17
390 0.15
391 0.11
392 0.11
393 0.1
394 0.08
395 0.08
396 0.08
397 0.1
398 0.1
399 0.08
400 0.07
401 0.08
402 0.08
403 0.09
404 0.08
405 0.07
406 0.07
407 0.07
408 0.07
409 0.06
410 0.06
411 0.05
412 0.07
413 0.06
414 0.06
415 0.06
416 0.06
417 0.06
418 0.08
419 0.1
420 0.09
421 0.12
422 0.16
423 0.15