Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1S545

Protein Details
Accession N1S545    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-36PEIQLRSASRKSKNRKVGRPASSNSHydrophilic
NLS Segment(s)
PositionSequence
21-28RKSKNRKV
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MVLSRSNSSQDPEIQLRSASRKSKNRKVGRPASSNSQAHARKCHNLVEKQYRTRLKAQFENLLTVLPTAQDPDYVGKDATGNPGRYLSRGQVLDAARERILKLENEAELSTLRCNRLLKDIARMERTLLEEKNRAALSFWSAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.31
4 0.34
5 0.37
6 0.39
7 0.44
8 0.52
9 0.61
10 0.7
11 0.77
12 0.81
13 0.83
14 0.86
15 0.86
16 0.85
17 0.83
18 0.76
19 0.74
20 0.72
21 0.63
22 0.54
23 0.53
24 0.49
25 0.44
26 0.48
27 0.44
28 0.4
29 0.42
30 0.48
31 0.46
32 0.47
33 0.54
34 0.57
35 0.6
36 0.6
37 0.66
38 0.63
39 0.59
40 0.61
41 0.58
42 0.53
43 0.52
44 0.51
45 0.49
46 0.45
47 0.43
48 0.35
49 0.3
50 0.23
51 0.17
52 0.14
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.07
60 0.08
61 0.09
62 0.09
63 0.08
64 0.09
65 0.09
66 0.15
67 0.18
68 0.17
69 0.17
70 0.2
71 0.2
72 0.2
73 0.22
74 0.17
75 0.17
76 0.17
77 0.17
78 0.2
79 0.2
80 0.23
81 0.24
82 0.24
83 0.2
84 0.2
85 0.2
86 0.16
87 0.18
88 0.14
89 0.15
90 0.16
91 0.16
92 0.17
93 0.17
94 0.16
95 0.15
96 0.15
97 0.16
98 0.16
99 0.17
100 0.18
101 0.2
102 0.2
103 0.27
104 0.32
105 0.3
106 0.37
107 0.43
108 0.46
109 0.49
110 0.47
111 0.42
112 0.39
113 0.42
114 0.38
115 0.34
116 0.33
117 0.34
118 0.34
119 0.4
120 0.37
121 0.33
122 0.29
123 0.27