Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RYI1

Protein Details
Accession N1RYI1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
132-161KDDTEKESAKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
103-153AAIGGRKRKVGKVIGEASDEGKGEDKKKEKDDTEKESAKNRKPKKKAKKIK
Subcellular Location(s) cyto_nucl 12.833, cyto 12, nucl 11.5, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKINSKNLSYDTEAAAPPFLAALRAQAAGATGPDPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVSLEVDKDGVVKDTGDYDVEPAAEKETAKESESKAAIGGRKRKVGKVIGEASDEGKGEDKKKEKDDTEKESAKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.23
5 0.18
6 0.13
7 0.12
8 0.09
9 0.07
10 0.06
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.08
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.11
26 0.12
27 0.13
28 0.18
29 0.27
30 0.33
31 0.39
32 0.45
33 0.46
34 0.53
35 0.59
36 0.61
37 0.6
38 0.59
39 0.58
40 0.56
41 0.5
42 0.43
43 0.35
44 0.28
45 0.2
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.1
82 0.11
83 0.12
84 0.14
85 0.14
86 0.19
87 0.19
88 0.18
89 0.16
90 0.18
91 0.21
92 0.25
93 0.32
94 0.31
95 0.38
96 0.4
97 0.42
98 0.45
99 0.47
100 0.45
101 0.45
102 0.46
103 0.4
104 0.4
105 0.38
106 0.33
107 0.28
108 0.24
109 0.16
110 0.15
111 0.16
112 0.17
113 0.25
114 0.31
115 0.36
116 0.42
117 0.49
118 0.51
119 0.58
120 0.64
121 0.65
122 0.67
123 0.67
124 0.64
125 0.66
126 0.7
127 0.68
128 0.7
129 0.72
130 0.74
131 0.78
132 0.87
133 0.89
134 0.91
135 0.93
136 0.94
137 0.95
138 0.94
139 0.95
140 0.93
141 0.9