Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1S2B0

Protein Details
Accession N1S2B0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
148-172PLKTSAKPKKTPKPKIAKPKPPAEPBasic
180-204PTTAAKTKKTPKPKTAKPKPPAEPIHydrophilic
NLS Segment(s)
PositionSequence
147-200APLKTSAKPKKTPKPKIAKPKPPAEPTTAAKTEPTTAAKTKKTPKPKTAKPKPP
Subcellular Location(s) mito 12.5, cyto_mito 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
IPR036930  WGR_dom_sf  
IPR008893  WGR_domain  
Pfam View protein in Pfam  
PF00533  BRCT  
PF05406  WGR  
PROSITE View protein in PROSITE  
PS50172  BRCT  
PS51977  WGR  
Amino Acid Sequences MPPRNKGVANPFAGCVITVCGRPGTIGGKKWYHQDFKTIIVKYGGRSVRNVTDATTHVVATKDSLCGDTAIMAAARRRENLSFMMPEWLIDTDTKKKKLNAKEYAWTDLEKLRVSRLKTQSAKTKTAKKIAEAEAPVKDEPKEDGEAPLKTSAKPKKTPKPKIAKPKPPAEPTTAAKTEPTTAAKTKKTPKPKTAKPKPPAEPIPPDPYHIWADPKSGVIYDAYLNKPSEFFHIQVVEDPETSKIWTRTRCGPIGELGSVRLLGNGDREEAVKMFERKFKSQSGLAWGNRSEASKPGKYAYVPHYGGDNDTTDHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.22
3 0.17
4 0.15
5 0.14
6 0.14
7 0.14
8 0.14
9 0.14
10 0.16
11 0.2
12 0.23
13 0.28
14 0.33
15 0.37
16 0.39
17 0.47
18 0.53
19 0.53
20 0.49
21 0.52
22 0.47
23 0.5
24 0.56
25 0.49
26 0.43
27 0.4
28 0.4
29 0.33
30 0.4
31 0.37
32 0.31
33 0.32
34 0.34
35 0.35
36 0.36
37 0.35
38 0.27
39 0.26
40 0.26
41 0.28
42 0.24
43 0.19
44 0.18
45 0.19
46 0.17
47 0.16
48 0.16
49 0.12
50 0.12
51 0.13
52 0.12
53 0.11
54 0.11
55 0.1
56 0.08
57 0.08
58 0.08
59 0.08
60 0.1
61 0.14
62 0.15
63 0.17
64 0.19
65 0.2
66 0.22
67 0.24
68 0.25
69 0.22
70 0.22
71 0.24
72 0.21
73 0.2
74 0.18
75 0.16
76 0.13
77 0.12
78 0.15
79 0.21
80 0.28
81 0.32
82 0.35
83 0.4
84 0.47
85 0.56
86 0.63
87 0.63
88 0.61
89 0.65
90 0.64
91 0.63
92 0.56
93 0.47
94 0.38
95 0.31
96 0.28
97 0.22
98 0.19
99 0.2
100 0.23
101 0.25
102 0.33
103 0.36
104 0.43
105 0.46
106 0.5
107 0.55
108 0.56
109 0.61
110 0.58
111 0.62
112 0.59
113 0.62
114 0.58
115 0.52
116 0.53
117 0.48
118 0.48
119 0.4
120 0.36
121 0.3
122 0.31
123 0.28
124 0.22
125 0.19
126 0.14
127 0.14
128 0.14
129 0.14
130 0.12
131 0.15
132 0.17
133 0.17
134 0.18
135 0.2
136 0.19
137 0.18
138 0.25
139 0.29
140 0.32
141 0.4
142 0.47
143 0.54
144 0.64
145 0.72
146 0.74
147 0.79
148 0.8
149 0.84
150 0.85
151 0.86
152 0.81
153 0.8
154 0.78
155 0.72
156 0.67
157 0.6
158 0.55
159 0.47
160 0.47
161 0.39
162 0.32
163 0.28
164 0.25
165 0.22
166 0.2
167 0.19
168 0.16
169 0.19
170 0.24
171 0.27
172 0.33
173 0.41
174 0.46
175 0.55
176 0.6
177 0.66
178 0.7
179 0.77
180 0.82
181 0.84
182 0.87
183 0.83
184 0.85
185 0.81
186 0.79
187 0.76
188 0.71
189 0.67
190 0.61
191 0.62
192 0.52
193 0.5
194 0.42
195 0.39
196 0.36
197 0.29
198 0.29
199 0.21
200 0.23
201 0.21
202 0.21
203 0.18
204 0.15
205 0.14
206 0.11
207 0.11
208 0.1
209 0.15
210 0.15
211 0.18
212 0.18
213 0.18
214 0.18
215 0.18
216 0.22
217 0.2
218 0.19
219 0.2
220 0.21
221 0.21
222 0.24
223 0.27
224 0.22
225 0.2
226 0.2
227 0.17
228 0.16
229 0.17
230 0.18
231 0.19
232 0.24
233 0.29
234 0.33
235 0.41
236 0.46
237 0.48
238 0.46
239 0.43
240 0.41
241 0.39
242 0.37
243 0.28
244 0.23
245 0.2
246 0.18
247 0.16
248 0.13
249 0.1
250 0.09
251 0.12
252 0.12
253 0.13
254 0.13
255 0.14
256 0.14
257 0.14
258 0.16
259 0.19
260 0.23
261 0.25
262 0.31
263 0.37
264 0.4
265 0.44
266 0.47
267 0.46
268 0.45
269 0.45
270 0.47
271 0.5
272 0.47
273 0.48
274 0.43
275 0.41
276 0.39
277 0.37
278 0.3
279 0.28
280 0.33
281 0.32
282 0.34
283 0.34
284 0.36
285 0.35
286 0.41
287 0.39
288 0.42
289 0.39
290 0.37
291 0.37
292 0.34
293 0.35
294 0.3
295 0.26