Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RXD8

Protein Details
Accession N1RXD8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
93-114LVTSKTESDKNRKPKPKRDILKHydrophilic
NLS Segment(s)
PositionSequence
102-114KNRKPKPKRDILK
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008422  Homeobox_KN_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05920  Homeobox_KN  
Amino Acid Sequences MLELQTGLTRTQITNWLANARRRRTTTDSGTQTASGKSGKVPSEYTPTRAGTPIPRRRSEKGMHPLQRWVDSPPENEPAAVSAIAHAMASGELVTSKTESDKNRKPKPKRDILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.32
4 0.36
5 0.43
6 0.5
7 0.5
8 0.54
9 0.54
10 0.59
11 0.59
12 0.62
13 0.61
14 0.62
15 0.6
16 0.55
17 0.53
18 0.47
19 0.41
20 0.33
21 0.27
22 0.18
23 0.13
24 0.13
25 0.16
26 0.16
27 0.17
28 0.19
29 0.19
30 0.27
31 0.27
32 0.29
33 0.28
34 0.27
35 0.26
36 0.25
37 0.24
38 0.24
39 0.34
40 0.4
41 0.42
42 0.46
43 0.5
44 0.52
45 0.57
46 0.52
47 0.51
48 0.51
49 0.55
50 0.56
51 0.53
52 0.54
53 0.5
54 0.49
55 0.41
56 0.34
57 0.3
58 0.26
59 0.27
60 0.25
61 0.27
62 0.24
63 0.23
64 0.21
65 0.16
66 0.15
67 0.13
68 0.1
69 0.06
70 0.07
71 0.07
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.03
79 0.04
80 0.05
81 0.06
82 0.06
83 0.07
84 0.1
85 0.16
86 0.23
87 0.33
88 0.42
89 0.52
90 0.62
91 0.72
92 0.79
93 0.84
94 0.88