Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RNJ8

Protein Details
Accession N1RNJ8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-49IVLKPIRPPRQKSKSLRNRRVSPAVHydrophilic
NLS Segment(s)
PositionSequence
31-41RPPRQKSKSLR
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTCEGYKTRLTWGSSDTASSAGGGIVLKPIRPPRQKSKSLRNRRVSPAVETVGDPLVDLPDFSSMQSPDELDLLCLQFESLSEGLPDEEVSQKLMNTWYSYYHRIPDAHRSCRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.24
4 0.18
5 0.16
6 0.14
7 0.11
8 0.07
9 0.07
10 0.06
11 0.06
12 0.09
13 0.09
14 0.1
15 0.14
16 0.21
17 0.3
18 0.38
19 0.45
20 0.52
21 0.61
22 0.71
23 0.75
24 0.79
25 0.81
26 0.84
27 0.88
28 0.86
29 0.83
30 0.8
31 0.8
32 0.7
33 0.63
34 0.56
35 0.47
36 0.38
37 0.31
38 0.26
39 0.18
40 0.16
41 0.12
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.05
48 0.05
49 0.06
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.08
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.08
73 0.09
74 0.06
75 0.09
76 0.09
77 0.11
78 0.11
79 0.11
80 0.12
81 0.14
82 0.15
83 0.15
84 0.16
85 0.2
86 0.24
87 0.3
88 0.31
89 0.32
90 0.35
91 0.36
92 0.38
93 0.44
94 0.48