Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DYR0

Protein Details
Accession B0DYR0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-33RCPTCFCSKAVHRHRRWKARVVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 5, plas 5, cyto 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_314517  -  
Amino Acid Sequences MLVVLGLEFERCPTCFCSKAVHRHRRWKARVVVHPSLASNFPKSPSVHPSTPPWSIIANPSLMRITIVQPRWVHSILSVPPLFRRRAFRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.32
5 0.38
6 0.48
7 0.57
8 0.63
9 0.67
10 0.75
11 0.84
12 0.86
13 0.84
14 0.82
15 0.8
16 0.78
17 0.78
18 0.76
19 0.7
20 0.62
21 0.57
22 0.48
23 0.41
24 0.34
25 0.27
26 0.2
27 0.16
28 0.15
29 0.18
30 0.19
31 0.2
32 0.23
33 0.28
34 0.27
35 0.28
36 0.32
37 0.33
38 0.33
39 0.31
40 0.26
41 0.21
42 0.2
43 0.2
44 0.17
45 0.15
46 0.13
47 0.14
48 0.13
49 0.13
50 0.13
51 0.11
52 0.13
53 0.18
54 0.2
55 0.25
56 0.25
57 0.28
58 0.32
59 0.32
60 0.29
61 0.22
62 0.27
63 0.23
64 0.3
65 0.28
66 0.24
67 0.3
68 0.35
69 0.38
70 0.37