Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RI28

Protein Details
Accession N1RI28   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-86LEQKKRDLAQRKRDISRKRRAVSQEKQKQQQKQHydrophilic
NLS Segment(s)
PositionSequence
50-75KKRDLEQKKRDLAQRKRDISRKRRAV
Subcellular Location(s) extr 12, mito 7, plas 3, golg 2, nucl 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MRFSIFTLVALVSASSASLVRRVDVNVPAMTNADGVVVPFDTAGVVQPAKKRDLEQKKRDLAQRKRDISRKRRAVSQEKQKQQQKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.05
5 0.09
6 0.09
7 0.1
8 0.11
9 0.13
10 0.15
11 0.17
12 0.2
13 0.17
14 0.17
15 0.17
16 0.16
17 0.15
18 0.12
19 0.09
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.06
34 0.1
35 0.12
36 0.14
37 0.15
38 0.18
39 0.27
40 0.38
41 0.47
42 0.53
43 0.6
44 0.65
45 0.69
46 0.74
47 0.75
48 0.73
49 0.74
50 0.75
51 0.73
52 0.75
53 0.79
54 0.82
55 0.81
56 0.83
57 0.82
58 0.75
59 0.76
60 0.78
61 0.79
62 0.79
63 0.8
64 0.8
65 0.79
66 0.86