Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DUX0

Protein Details
Accession B0DUX0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-70QGPFPCRRLRTTRKRPRVPRQPQSPIGASHydrophilic
NLS Segment(s)
PositionSequence
55-57KRP
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 4
Family & Domain DBs
KEGG lbc:LACBIDRAFT_310695  -  
Amino Acid Sequences MPSGLRCSVNTYRDCAPSVERYIEWGGVELKALPLSSITLTQGPFPCRRLRTTRKRPRVPRQPQSPIGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.34
3 0.31
4 0.3
5 0.31
6 0.3
7 0.25
8 0.26
9 0.26
10 0.24
11 0.2
12 0.16
13 0.14
14 0.11
15 0.11
16 0.08
17 0.07
18 0.06
19 0.06
20 0.05
21 0.04
22 0.05
23 0.05
24 0.06
25 0.06
26 0.08
27 0.08
28 0.11
29 0.14
30 0.17
31 0.19
32 0.22
33 0.27
34 0.28
35 0.34
36 0.41
37 0.49
38 0.57
39 0.66
40 0.74
41 0.79
42 0.87
43 0.92
44 0.94
45 0.94
46 0.94
47 0.93
48 0.92
49 0.91
50 0.86