Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RZK1

Protein Details
Accession N1RZK1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
119-149RTTPVTKAEGKKRNRRKPRDKKNARRTKTEIBasic
NLS Segment(s)
PositionSequence
125-166KAEGKKRNRRKPRDKKNARRTKTEINREEKKRYMKVLERNRR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MPEGLHPWDWDISSNTLYNICAMPGTLIPPSSSEYCESDAITGSMLNDEGLYSAPLSGSLSSTHSVEEYFQSESRIQQECLYEEATLGILQDHHGSLSTATDSIPNSTPPEVSASIKTRTTPVTKAEGKKRNRRKPRDKKNARRTKTEINREEKKRYMKVLERNRRAAANCRARKQEQQDKLNAELEKLQDRHKELFASCNELRETAYQLKLQLLRHGDCGCALIQRFIANEAVNSVETLISKQSPSSSPNCTTASTTVSASANSPRRGLGGNNGWDKPPSMFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.2
5 0.19
6 0.16
7 0.13
8 0.1
9 0.1
10 0.1
11 0.1
12 0.12
13 0.11
14 0.11
15 0.11
16 0.13
17 0.17
18 0.17
19 0.18
20 0.19
21 0.2
22 0.22
23 0.23
24 0.22
25 0.19
26 0.18
27 0.16
28 0.14
29 0.11
30 0.09
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.05
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.16
59 0.16
60 0.18
61 0.22
62 0.23
63 0.22
64 0.22
65 0.24
66 0.23
67 0.24
68 0.23
69 0.17
70 0.14
71 0.13
72 0.11
73 0.09
74 0.07
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.06
87 0.06
88 0.08
89 0.08
90 0.1
91 0.11
92 0.11
93 0.13
94 0.13
95 0.13
96 0.12
97 0.15
98 0.14
99 0.15
100 0.18
101 0.19
102 0.21
103 0.22
104 0.22
105 0.2
106 0.22
107 0.23
108 0.22
109 0.22
110 0.26
111 0.32
112 0.38
113 0.46
114 0.51
115 0.57
116 0.64
117 0.72
118 0.75
119 0.8
120 0.85
121 0.87
122 0.9
123 0.93
124 0.94
125 0.95
126 0.95
127 0.96
128 0.95
129 0.88
130 0.84
131 0.78
132 0.78
133 0.76
134 0.75
135 0.71
136 0.68
137 0.73
138 0.7
139 0.7
140 0.65
141 0.62
142 0.55
143 0.51
144 0.5
145 0.48
146 0.53
147 0.59
148 0.64
149 0.63
150 0.64
151 0.62
152 0.58
153 0.53
154 0.52
155 0.5
156 0.51
157 0.5
158 0.51
159 0.55
160 0.55
161 0.6
162 0.61
163 0.61
164 0.59
165 0.59
166 0.6
167 0.58
168 0.57
169 0.55
170 0.46
171 0.37
172 0.31
173 0.27
174 0.27
175 0.25
176 0.27
177 0.26
178 0.3
179 0.32
180 0.31
181 0.32
182 0.26
183 0.32
184 0.29
185 0.32
186 0.29
187 0.29
188 0.28
189 0.26
190 0.26
191 0.2
192 0.24
193 0.21
194 0.23
195 0.21
196 0.21
197 0.25
198 0.28
199 0.28
200 0.28
201 0.28
202 0.27
203 0.3
204 0.3
205 0.26
206 0.22
207 0.23
208 0.18
209 0.17
210 0.16
211 0.13
212 0.13
213 0.14
214 0.14
215 0.14
216 0.16
217 0.12
218 0.12
219 0.12
220 0.12
221 0.11
222 0.11
223 0.1
224 0.08
225 0.08
226 0.09
227 0.11
228 0.11
229 0.11
230 0.12
231 0.15
232 0.17
233 0.21
234 0.25
235 0.29
236 0.31
237 0.36
238 0.37
239 0.36
240 0.36
241 0.34
242 0.33
243 0.28
244 0.25
245 0.23
246 0.22
247 0.2
248 0.19
249 0.26
250 0.3
251 0.3
252 0.31
253 0.28
254 0.29
255 0.31
256 0.31
257 0.32
258 0.33
259 0.4
260 0.45
261 0.46
262 0.45
263 0.44
264 0.44