Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DNK5

Protein Details
Accession B0DNK5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
39-59LRSKIRCRKGHVECSKDRKTNBasic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_306701  -  
Amino Acid Sequences MHTTVFALTCSNAYTHRHLLLPPHCIRRHCKFEESMLILRSKIRCRKGHVECSKDRKTNGWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.24
5 0.24
6 0.31
7 0.32
8 0.37
9 0.36
10 0.42
11 0.43
12 0.45
13 0.51
14 0.51
15 0.55
16 0.5
17 0.49
18 0.42
19 0.42
20 0.45
21 0.43
22 0.37
23 0.31
24 0.28
25 0.24
26 0.26
27 0.27
28 0.3
29 0.33
30 0.39
31 0.42
32 0.5
33 0.6
34 0.66
35 0.73
36 0.74
37 0.75
38 0.76
39 0.81
40 0.82
41 0.77
42 0.7