Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RKW7

Protein Details
Accession N1RKW7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
167-187HDPEERRRRNQENRSRYRDRDBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MDLDIEMDDAVDTVHDAPILDVGRDDILQPDEPEEPGEVAEDEPPTDDSKTLIPTKIHIKGVDSLHTSDIKAYVKAHFGDVDRIEWIDDSSANLLFPSEPTARDAIVALSSVPVADATALAIGETLPAKPFEGKPEISLQVRFAIQSDKKEVGAALRSRYYLLHPEHDPEERRRRNQENRSRYRDRDDGYHRGGEGRRRRASDDDVETFEASMYDDAPRPTRRRRDSDIEERPRSYARENQGKELFSGRKSQRDRSASPRRDNDGDDLMGERASSSGNRTRARDLKDRISGSNNSKELFPTKKSIKQFGGGNLDTLERAIGSARLKDEDRPKIVSVPNARGDGNSFNIRGMASQQGSGEGFAIKGAASANARELFPTKLGSNNTGKELFGGGRSKQRQKAEDLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.12
6 0.13
7 0.12
8 0.11
9 0.12
10 0.12
11 0.13
12 0.13
13 0.11
14 0.14
15 0.16
16 0.16
17 0.18
18 0.18
19 0.18
20 0.19
21 0.17
22 0.14
23 0.12
24 0.13
25 0.11
26 0.1
27 0.12
28 0.12
29 0.11
30 0.12
31 0.13
32 0.14
33 0.14
34 0.13
35 0.13
36 0.15
37 0.21
38 0.23
39 0.26
40 0.25
41 0.28
42 0.36
43 0.41
44 0.42
45 0.37
46 0.36
47 0.38
48 0.41
49 0.42
50 0.37
51 0.32
52 0.31
53 0.32
54 0.29
55 0.23
56 0.24
57 0.21
58 0.19
59 0.2
60 0.19
61 0.22
62 0.22
63 0.23
64 0.22
65 0.22
66 0.26
67 0.25
68 0.24
69 0.21
70 0.2
71 0.19
72 0.16
73 0.15
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.08
83 0.08
84 0.12
85 0.12
86 0.12
87 0.15
88 0.16
89 0.15
90 0.15
91 0.15
92 0.11
93 0.1
94 0.09
95 0.07
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.04
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.1
117 0.11
118 0.16
119 0.2
120 0.2
121 0.22
122 0.26
123 0.29
124 0.28
125 0.28
126 0.23
127 0.2
128 0.2
129 0.18
130 0.14
131 0.19
132 0.19
133 0.21
134 0.25
135 0.24
136 0.23
137 0.24
138 0.23
139 0.18
140 0.22
141 0.21
142 0.2
143 0.2
144 0.2
145 0.2
146 0.21
147 0.2
148 0.21
149 0.21
150 0.23
151 0.22
152 0.24
153 0.26
154 0.3
155 0.31
156 0.32
157 0.41
158 0.43
159 0.48
160 0.53
161 0.6
162 0.66
163 0.73
164 0.76
165 0.76
166 0.79
167 0.82
168 0.81
169 0.75
170 0.71
171 0.65
172 0.56
173 0.54
174 0.51
175 0.48
176 0.45
177 0.43
178 0.37
179 0.35
180 0.36
181 0.36
182 0.37
183 0.4
184 0.41
185 0.41
186 0.43
187 0.43
188 0.46
189 0.43
190 0.4
191 0.33
192 0.31
193 0.3
194 0.27
195 0.24
196 0.19
197 0.13
198 0.08
199 0.06
200 0.05
201 0.05
202 0.07
203 0.08
204 0.12
205 0.17
206 0.22
207 0.3
208 0.39
209 0.45
210 0.5
211 0.56
212 0.61
213 0.65
214 0.71
215 0.74
216 0.73
217 0.7
218 0.63
219 0.58
220 0.51
221 0.44
222 0.37
223 0.33
224 0.31
225 0.38
226 0.38
227 0.43
228 0.45
229 0.44
230 0.41
231 0.4
232 0.35
233 0.27
234 0.35
235 0.31
236 0.36
237 0.39
238 0.45
239 0.48
240 0.52
241 0.55
242 0.56
243 0.65
244 0.65
245 0.69
246 0.68
247 0.64
248 0.61
249 0.58
250 0.52
251 0.44
252 0.35
253 0.28
254 0.23
255 0.18
256 0.15
257 0.13
258 0.09
259 0.06
260 0.06
261 0.06
262 0.1
263 0.16
264 0.23
265 0.27
266 0.29
267 0.36
268 0.42
269 0.48
270 0.53
271 0.53
272 0.53
273 0.57
274 0.57
275 0.53
276 0.52
277 0.52
278 0.48
279 0.51
280 0.44
281 0.38
282 0.36
283 0.35
284 0.35
285 0.34
286 0.31
287 0.31
288 0.35
289 0.42
290 0.46
291 0.52
292 0.49
293 0.49
294 0.5
295 0.49
296 0.51
297 0.44
298 0.4
299 0.34
300 0.31
301 0.26
302 0.22
303 0.15
304 0.06
305 0.06
306 0.06
307 0.09
308 0.1
309 0.13
310 0.15
311 0.18
312 0.19
313 0.26
314 0.34
315 0.39
316 0.41
317 0.42
318 0.42
319 0.46
320 0.47
321 0.48
322 0.46
323 0.45
324 0.45
325 0.44
326 0.42
327 0.36
328 0.37
329 0.32
330 0.31
331 0.28
332 0.23
333 0.21
334 0.22
335 0.21
336 0.19
337 0.18
338 0.2
339 0.17
340 0.18
341 0.18
342 0.19
343 0.19
344 0.19
345 0.17
346 0.11
347 0.1
348 0.08
349 0.08
350 0.06
351 0.06
352 0.06
353 0.09
354 0.1
355 0.11
356 0.16
357 0.18
358 0.18
359 0.19
360 0.21
361 0.2
362 0.2
363 0.23
364 0.2
365 0.24
366 0.27
367 0.32
368 0.37
369 0.38
370 0.41
371 0.39
372 0.37
373 0.32
374 0.32
375 0.27
376 0.25
377 0.27
378 0.25
379 0.34
380 0.43
381 0.51
382 0.56
383 0.63
384 0.62
385 0.66