Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1S1K1

Protein Details
Accession N1S1K1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-75TTRSSPRSSHRPGERKRKRPHSSHRDSSEQBasic
NLS Segment(s)
PositionSequence
52-66RSSHRPGERKRKRPH
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MEAAPITVAVVHTPYWNISDVAFLRDGPHNVLVPALLYLRASNIETTRSSPRSSHRPGERKRKRPHSSHRDSSEQPVHQSSRDSEAELSNASPCSVGSDDSSCQHDRDPSNILHKLNMTEHERLLLHDLENEIRQDEYYGSARSTPSFTLASKRRRHDGEALRVREQKSPEEEKDEYERLNNPRGSPITVRGAHPRSVTLIIDNVQGEYQTQALPRQDCKKDWVDFAELEGPNLEGDETTIHPNDIQDSQFIRLQWLKERKGTVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.14
5 0.12
6 0.18
7 0.17
8 0.2
9 0.19
10 0.18
11 0.19
12 0.23
13 0.24
14 0.22
15 0.24
16 0.21
17 0.21
18 0.21
19 0.17
20 0.13
21 0.13
22 0.1
23 0.08
24 0.07
25 0.07
26 0.08
27 0.1
28 0.11
29 0.12
30 0.13
31 0.15
32 0.16
33 0.2
34 0.27
35 0.28
36 0.29
37 0.3
38 0.36
39 0.43
40 0.48
41 0.54
42 0.56
43 0.64
44 0.71
45 0.79
46 0.83
47 0.84
48 0.88
49 0.9
50 0.88
51 0.88
52 0.9
53 0.9
54 0.89
55 0.88
56 0.84
57 0.79
58 0.73
59 0.7
60 0.66
61 0.57
62 0.5
63 0.45
64 0.4
65 0.35
66 0.35
67 0.29
68 0.27
69 0.25
70 0.24
71 0.2
72 0.2
73 0.19
74 0.17
75 0.16
76 0.11
77 0.11
78 0.09
79 0.08
80 0.07
81 0.09
82 0.09
83 0.09
84 0.09
85 0.11
86 0.12
87 0.14
88 0.18
89 0.16
90 0.16
91 0.17
92 0.21
93 0.19
94 0.21
95 0.23
96 0.21
97 0.27
98 0.3
99 0.29
100 0.25
101 0.25
102 0.24
103 0.22
104 0.24
105 0.22
106 0.19
107 0.19
108 0.19
109 0.19
110 0.17
111 0.19
112 0.15
113 0.11
114 0.11
115 0.11
116 0.1
117 0.11
118 0.11
119 0.08
120 0.07
121 0.07
122 0.07
123 0.06
124 0.08
125 0.09
126 0.09
127 0.09
128 0.1
129 0.11
130 0.11
131 0.12
132 0.1
133 0.11
134 0.12
135 0.12
136 0.19
137 0.26
138 0.35
139 0.4
140 0.43
141 0.47
142 0.48
143 0.52
144 0.53
145 0.54
146 0.56
147 0.58
148 0.59
149 0.58
150 0.59
151 0.57
152 0.52
153 0.45
154 0.39
155 0.36
156 0.39
157 0.36
158 0.39
159 0.38
160 0.37
161 0.41
162 0.38
163 0.31
164 0.27
165 0.31
166 0.28
167 0.35
168 0.33
169 0.28
170 0.32
171 0.33
172 0.34
173 0.3
174 0.31
175 0.31
176 0.32
177 0.33
178 0.36
179 0.37
180 0.37
181 0.36
182 0.32
183 0.28
184 0.28
185 0.26
186 0.19
187 0.18
188 0.15
189 0.17
190 0.16
191 0.14
192 0.12
193 0.11
194 0.1
195 0.09
196 0.09
197 0.08
198 0.09
199 0.13
200 0.17
201 0.21
202 0.27
203 0.35
204 0.39
205 0.4
206 0.45
207 0.48
208 0.47
209 0.48
210 0.46
211 0.41
212 0.36
213 0.37
214 0.39
215 0.31
216 0.29
217 0.25
218 0.21
219 0.17
220 0.17
221 0.13
222 0.05
223 0.06
224 0.08
225 0.09
226 0.13
227 0.14
228 0.14
229 0.14
230 0.15
231 0.18
232 0.19
233 0.18
234 0.18
235 0.19
236 0.22
237 0.24
238 0.24
239 0.27
240 0.28
241 0.3
242 0.37
243 0.44
244 0.46
245 0.49