Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RK95

Protein Details
Accession N1RK95    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTGKRSRKGCGECRKRRRKCDEVKPSCGQCBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTGKRSRKGCGECRKRRRKCDEVKPSCGQCVSNHRSCKYELRLVWSQGVQNRRSGMRVPEMKAISLTDPIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.92
4 0.92
5 0.91
6 0.9
7 0.9
8 0.91
9 0.88
10 0.86
11 0.82
12 0.74
13 0.65
14 0.55
15 0.45
16 0.37
17 0.39
18 0.37
19 0.38
20 0.4
21 0.39
22 0.4
23 0.41
24 0.44
25 0.39
26 0.39
27 0.33
28 0.36
29 0.39
30 0.38
31 0.39
32 0.33
33 0.31
34 0.29
35 0.34
36 0.28
37 0.27
38 0.28
39 0.27
40 0.28
41 0.28
42 0.29
43 0.32
44 0.38
45 0.38
46 0.43
47 0.43
48 0.41
49 0.39
50 0.36
51 0.28