Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RGC5

Protein Details
Accession N1RGC5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
50-73YGSYGAKPKPKPKPAPAPKKYTNYHydrophilic
132-155YGSYGAKPKPKPKPAPAPKKYTNYHydrophilic
NLS Segment(s)
PositionSequence
56-69KPKPKPKPAPAPKK
138-151KPKPKPKPAPAPKK
Subcellular Location(s) extr 19, mito 2, cyto 2, E.R. 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKLTAVTLLTLAAGAMAAPVAEAAPEAAPGYTTYGDYKGAGENLPSYPSYGSYGAKPKPKPKPAPAPKKYTNYGSYNYKKYSSYGHYKREAEPEAAPEAAPEAAPEAEAAPGYTTYGDYKGAGENLPSYPSYGSYGAKPKPKPKPAPAPKKYTNYGSYNYKKYSSYGHYKREAEPEAAPEAEAEPETYSKYGSYPKKYTNYGSYNYKKYSSYGTYKRAKEFINSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.09
18 0.09
19 0.1
20 0.12
21 0.13
22 0.14
23 0.14
24 0.14
25 0.14
26 0.14
27 0.13
28 0.13
29 0.14
30 0.13
31 0.15
32 0.14
33 0.13
34 0.12
35 0.13
36 0.15
37 0.15
38 0.15
39 0.18
40 0.26
41 0.3
42 0.37
43 0.42
44 0.48
45 0.56
46 0.65
47 0.7
48 0.71
49 0.77
50 0.8
51 0.86
52 0.84
53 0.83
54 0.8
55 0.78
56 0.72
57 0.67
58 0.62
59 0.55
60 0.53
61 0.53
62 0.51
63 0.5
64 0.49
65 0.45
66 0.39
67 0.36
68 0.37
69 0.33
70 0.38
71 0.4
72 0.45
73 0.49
74 0.51
75 0.53
76 0.53
77 0.49
78 0.41
79 0.34
80 0.3
81 0.25
82 0.22
83 0.19
84 0.13
85 0.11
86 0.09
87 0.08
88 0.05
89 0.05
90 0.04
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.07
103 0.08
104 0.09
105 0.09
106 0.11
107 0.13
108 0.14
109 0.13
110 0.13
111 0.14
112 0.13
113 0.15
114 0.14
115 0.13
116 0.12
117 0.13
118 0.15
119 0.15
120 0.15
121 0.18
122 0.26
123 0.3
124 0.37
125 0.42
126 0.48
127 0.56
128 0.65
129 0.7
130 0.71
131 0.77
132 0.8
133 0.86
134 0.84
135 0.83
136 0.8
137 0.78
138 0.72
139 0.67
140 0.62
141 0.55
142 0.53
143 0.53
144 0.51
145 0.5
146 0.49
147 0.45
148 0.39
149 0.36
150 0.37
151 0.33
152 0.38
153 0.4
154 0.45
155 0.49
156 0.51
157 0.53
158 0.53
159 0.49
160 0.41
161 0.34
162 0.3
163 0.26
164 0.23
165 0.21
166 0.15
167 0.13
168 0.12
169 0.11
170 0.1
171 0.08
172 0.09
173 0.11
174 0.1
175 0.1
176 0.1
177 0.12
178 0.2
179 0.27
180 0.35
181 0.39
182 0.47
183 0.53
184 0.57
185 0.61
186 0.61
187 0.59
188 0.56
189 0.59
190 0.57
191 0.56
192 0.54
193 0.5
194 0.41
195 0.37
196 0.4
197 0.38
198 0.42
199 0.45
200 0.52
201 0.59
202 0.64
203 0.68
204 0.66
205 0.61
206 0.57