Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1R7Y2

Protein Details
Accession N1R7Y2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-79TLSNENVKKRKHKDKGQSADAKRPRBasic
NLS Segment(s)
PositionSequence
27-51KGLAKKEAREQKKRQAKAAKAKLAP
61-77VKKRKHKDKGQSADAKR
Subcellular Location(s) nucl 12, cyto 7, pero 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPYVWYPEALERLGAESWDEVRALGEKGLAKKEAREQKKRQAKAAKAKLAPGQTTLSNENVKKRKHKDKGQSADAKRPRVDGQHNGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.1
4 0.11
5 0.11
6 0.11
7 0.08
8 0.09
9 0.1
10 0.1
11 0.09
12 0.1
13 0.12
14 0.15
15 0.17
16 0.19
17 0.18
18 0.2
19 0.28
20 0.35
21 0.41
22 0.48
23 0.53
24 0.6
25 0.7
26 0.7
27 0.7
28 0.69
29 0.68
30 0.69
31 0.72
32 0.69
33 0.6
34 0.6
35 0.56
36 0.49
37 0.42
38 0.33
39 0.26
40 0.2
41 0.22
42 0.21
43 0.2
44 0.23
45 0.24
46 0.3
47 0.36
48 0.4
49 0.47
50 0.55
51 0.63
52 0.68
53 0.76
54 0.79
55 0.83
56 0.87
57 0.87
58 0.88
59 0.82
60 0.83
61 0.8
62 0.75
63 0.65
64 0.6
65 0.54
66 0.52
67 0.55