Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DMT2

Protein Details
Accession B0DMT2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
129-150DAVRRRAEKTHRSDVKKGRRGGBasic
NLS Segment(s)
PositionSequence
120-148KKVEALIKADAVRRRAEKTHRSDVKKGRR
Subcellular Location(s) mito_nucl 11.833, nucl 11.5, mito 11, cyto_mito 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG lbc:LACBIDRAFT_330957  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MAEARAWVEKFKAVSTLRGVGGVEMMFSRSSGPGGQNVNKVNTKATLRCPTNAPWIPEWARKELVKSSHYVASTHSILLTSTVHRSQSQNVEDCFNKLHSLILDASSAPIKKETTPEQKKKVEALIKADAVRRRAEKTHRSDVKKGRRGGDWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.32
4 0.28
5 0.28
6 0.27
7 0.2
8 0.2
9 0.15
10 0.11
11 0.07
12 0.08
13 0.07
14 0.07
15 0.08
16 0.07
17 0.08
18 0.1
19 0.11
20 0.15
21 0.2
22 0.23
23 0.28
24 0.3
25 0.34
26 0.34
27 0.34
28 0.3
29 0.29
30 0.3
31 0.28
32 0.33
33 0.37
34 0.37
35 0.38
36 0.4
37 0.39
38 0.45
39 0.45
40 0.41
41 0.33
42 0.37
43 0.38
44 0.4
45 0.4
46 0.33
47 0.32
48 0.29
49 0.3
50 0.29
51 0.3
52 0.26
53 0.25
54 0.24
55 0.25
56 0.25
57 0.23
58 0.2
59 0.19
60 0.18
61 0.16
62 0.14
63 0.1
64 0.1
65 0.1
66 0.1
67 0.07
68 0.08
69 0.1
70 0.11
71 0.12
72 0.14
73 0.16
74 0.22
75 0.25
76 0.26
77 0.26
78 0.28
79 0.27
80 0.27
81 0.25
82 0.19
83 0.16
84 0.12
85 0.13
86 0.09
87 0.12
88 0.11
89 0.11
90 0.1
91 0.1
92 0.1
93 0.12
94 0.12
95 0.1
96 0.11
97 0.12
98 0.12
99 0.18
100 0.26
101 0.35
102 0.45
103 0.54
104 0.61
105 0.65
106 0.66
107 0.64
108 0.64
109 0.59
110 0.52
111 0.5
112 0.47
113 0.45
114 0.44
115 0.46
116 0.42
117 0.38
118 0.4
119 0.37
120 0.36
121 0.41
122 0.48
123 0.53
124 0.57
125 0.65
126 0.69
127 0.73
128 0.78
129 0.81
130 0.83
131 0.81
132 0.79
133 0.73