Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1SAJ8

Protein Details
Accession N1SAJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-68RDSPSTPPRRAPRRNARGKKVAGRPKNQRDEEBasic
NLS Segment(s)
PositionSequence
43-63PPRRAPRRNARGKKVAGRPKN
Subcellular Location(s) mito 19.5, cyto_mito 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPALRETPSSQLAVQRRPLPSSAPKRTAAQTKEDANRDSPSTPPRRAPRRNARGKKVAGRPKNQRDEEEKNSPPSPSTPSLAFTKEYAVATHCTVIPGHGHVYYAEDHKPLFVPTAVMHVHHTPDIHTCPCHQAPATGLVPIPGMQMPSIGALGRGYGGEQGWNENTWGYVPGFELGDTSQMHGGFNFNRTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.44
4 0.45
5 0.45
6 0.44
7 0.48
8 0.53
9 0.55
10 0.54
11 0.54
12 0.55
13 0.6
14 0.63
15 0.55
16 0.52
17 0.48
18 0.5
19 0.55
20 0.55
21 0.52
22 0.45
23 0.45
24 0.41
25 0.36
26 0.33
27 0.35
28 0.38
29 0.39
30 0.45
31 0.52
32 0.6
33 0.67
34 0.74
35 0.75
36 0.79
37 0.87
38 0.88
39 0.87
40 0.85
41 0.83
42 0.81
43 0.8
44 0.79
45 0.76
46 0.75
47 0.78
48 0.79
49 0.82
50 0.76
51 0.71
52 0.69
53 0.69
54 0.66
55 0.64
56 0.56
57 0.51
58 0.49
59 0.45
60 0.37
61 0.31
62 0.29
63 0.24
64 0.23
65 0.19
66 0.2
67 0.22
68 0.23
69 0.21
70 0.16
71 0.16
72 0.15
73 0.15
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.09
81 0.09
82 0.09
83 0.08
84 0.07
85 0.08
86 0.07
87 0.08
88 0.07
89 0.09
90 0.09
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.11
97 0.09
98 0.09
99 0.07
100 0.08
101 0.07
102 0.12
103 0.11
104 0.12
105 0.13
106 0.13
107 0.14
108 0.14
109 0.14
110 0.11
111 0.14
112 0.17
113 0.16
114 0.16
115 0.17
116 0.22
117 0.23
118 0.24
119 0.21
120 0.19
121 0.19
122 0.24
123 0.23
124 0.17
125 0.17
126 0.14
127 0.15
128 0.14
129 0.13
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.08
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.05
144 0.06
145 0.07
146 0.08
147 0.09
148 0.12
149 0.13
150 0.14
151 0.14
152 0.13
153 0.13
154 0.11
155 0.13
156 0.1
157 0.1
158 0.1
159 0.11
160 0.11
161 0.11
162 0.11
163 0.09
164 0.13
165 0.12
166 0.13
167 0.15
168 0.15
169 0.15
170 0.14
171 0.18
172 0.17