Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RV03

Protein Details
Accession N1RV03    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
245-269EVVQPGYKDRRQKGKKHLRVDWELVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 14, cyto 12
Family & Domain DBs
Amino Acid Sequences RDMQTCLAESMKRANFNGVDEDRNYIRNLFIVSEPEGAAAHVLSTSPDDIVHPQLASSLHESGYLNEDFKVHLRERLKHETYLERGTNTIDGIIERLTYEYFEKTIKRTFDYTQCNPKEPEVWYLGVTGPIKDDGKDFGSEFVIVNSNDVTGIFMKRLDAITEIVKEQLDQAMDIGYAVENVVIGGFGNSPSLIAKLKEFLEGYHRENNCHVKLMTSQEGHPKNKDAEVVGTVEVDFTKHRNQLEVVQPGYKDRRQKGKKHLRVDWELVIKVVGRDLECKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.36
4 0.43
5 0.36
6 0.35
7 0.32
8 0.36
9 0.32
10 0.32
11 0.31
12 0.23
13 0.21
14 0.19
15 0.19
16 0.16
17 0.16
18 0.17
19 0.18
20 0.19
21 0.19
22 0.17
23 0.16
24 0.14
25 0.13
26 0.09
27 0.07
28 0.05
29 0.05
30 0.05
31 0.07
32 0.07
33 0.07
34 0.07
35 0.09
36 0.11
37 0.14
38 0.15
39 0.13
40 0.13
41 0.14
42 0.15
43 0.16
44 0.17
45 0.14
46 0.13
47 0.15
48 0.16
49 0.15
50 0.19
51 0.17
52 0.15
53 0.14
54 0.14
55 0.13
56 0.15
57 0.2
58 0.16
59 0.22
60 0.27
61 0.33
62 0.41
63 0.49
64 0.5
65 0.47
66 0.5
67 0.49
68 0.49
69 0.49
70 0.42
71 0.33
72 0.31
73 0.29
74 0.26
75 0.2
76 0.16
77 0.09
78 0.08
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.08
88 0.09
89 0.11
90 0.12
91 0.15
92 0.2
93 0.21
94 0.22
95 0.24
96 0.27
97 0.33
98 0.4
99 0.43
100 0.48
101 0.48
102 0.48
103 0.46
104 0.44
105 0.39
106 0.32
107 0.3
108 0.23
109 0.21
110 0.19
111 0.18
112 0.17
113 0.17
114 0.16
115 0.12
116 0.1
117 0.11
118 0.11
119 0.1
120 0.11
121 0.09
122 0.1
123 0.11
124 0.11
125 0.1
126 0.1
127 0.1
128 0.1
129 0.09
130 0.09
131 0.08
132 0.08
133 0.07
134 0.07
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.1
149 0.11
150 0.11
151 0.1
152 0.1
153 0.1
154 0.09
155 0.09
156 0.08
157 0.07
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.02
171 0.02
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.05
179 0.06
180 0.07
181 0.08
182 0.08
183 0.11
184 0.12
185 0.14
186 0.14
187 0.14
188 0.19
189 0.22
190 0.26
191 0.31
192 0.31
193 0.31
194 0.35
195 0.42
196 0.37
197 0.37
198 0.33
199 0.26
200 0.3
201 0.34
202 0.35
203 0.29
204 0.3
205 0.36
206 0.43
207 0.45
208 0.44
209 0.42
210 0.39
211 0.39
212 0.38
213 0.3
214 0.26
215 0.24
216 0.23
217 0.19
218 0.17
219 0.15
220 0.13
221 0.11
222 0.1
223 0.09
224 0.1
225 0.16
226 0.2
227 0.21
228 0.23
229 0.26
230 0.32
231 0.39
232 0.43
233 0.39
234 0.38
235 0.38
236 0.41
237 0.46
238 0.43
239 0.44
240 0.46
241 0.55
242 0.61
243 0.7
244 0.76
245 0.8
246 0.85
247 0.86
248 0.86
249 0.84
250 0.83
251 0.79
252 0.75
253 0.69
254 0.6
255 0.5
256 0.43
257 0.34
258 0.27
259 0.24
260 0.19
261 0.14