Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D7A9

Protein Details
Accession B0D7A9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
223-250EIPIPAEKPEKRRRSRSPCKRQTDVDQEHydrophilic
NLS Segment(s)
PositionSequence
230-238KPEKRRRSR
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_318867  -  
Amino Acid Sequences MVFPKPPLWRIIKTVDQNPGAGATPSTAVDLQTKAVNIACRLGNLSSFIPATKELLACKLLSPNEFKRNCKKIIALIEVARRTLISAGVQVYAFSYCSEPLAPCKRAYIDLLNMLQENRHNVDAALNARMQSLLVPLSPSFIIHKSGIPSSVVPPKSRADQRKAPATAWGPFPYTPSTAATTGPSLMPPPDAFPSVPDKDRQYSNSFRIQRKSSRPRLWTAEEIPIPAEKPEKRRRSRSPCKRQTDVDQENVIPQSHPRIYRPMPRRFGIFCTGKSSMHGPNPAERMGRPTNVRPLIRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.54
4 0.5
5 0.45
6 0.4
7 0.32
8 0.26
9 0.19
10 0.12
11 0.12
12 0.12
13 0.13
14 0.11
15 0.11
16 0.14
17 0.14
18 0.15
19 0.15
20 0.15
21 0.15
22 0.17
23 0.19
24 0.17
25 0.2
26 0.19
27 0.18
28 0.2
29 0.19
30 0.18
31 0.17
32 0.17
33 0.15
34 0.15
35 0.15
36 0.14
37 0.14
38 0.15
39 0.15
40 0.15
41 0.14
42 0.17
43 0.18
44 0.17
45 0.17
46 0.2
47 0.2
48 0.22
49 0.28
50 0.32
51 0.41
52 0.45
53 0.5
54 0.55
55 0.6
56 0.61
57 0.58
58 0.53
59 0.5
60 0.53
61 0.52
62 0.45
63 0.42
64 0.45
65 0.42
66 0.39
67 0.32
68 0.24
69 0.2
70 0.17
71 0.13
72 0.08
73 0.09
74 0.1
75 0.11
76 0.11
77 0.1
78 0.1
79 0.09
80 0.09
81 0.07
82 0.07
83 0.07
84 0.08
85 0.09
86 0.08
87 0.16
88 0.23
89 0.24
90 0.24
91 0.26
92 0.26
93 0.27
94 0.29
95 0.26
96 0.21
97 0.23
98 0.23
99 0.22
100 0.21
101 0.19
102 0.17
103 0.14
104 0.15
105 0.12
106 0.12
107 0.11
108 0.11
109 0.12
110 0.14
111 0.15
112 0.14
113 0.12
114 0.12
115 0.11
116 0.11
117 0.1
118 0.07
119 0.07
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.07
126 0.07
127 0.08
128 0.09
129 0.11
130 0.11
131 0.12
132 0.12
133 0.13
134 0.13
135 0.12
136 0.12
137 0.12
138 0.18
139 0.19
140 0.18
141 0.2
142 0.21
143 0.26
144 0.33
145 0.37
146 0.37
147 0.43
148 0.47
149 0.53
150 0.53
151 0.47
152 0.45
153 0.41
154 0.36
155 0.32
156 0.29
157 0.22
158 0.2
159 0.22
160 0.19
161 0.17
162 0.16
163 0.15
164 0.16
165 0.15
166 0.15
167 0.15
168 0.13
169 0.13
170 0.12
171 0.1
172 0.08
173 0.08
174 0.09
175 0.08
176 0.1
177 0.1
178 0.12
179 0.12
180 0.13
181 0.2
182 0.21
183 0.23
184 0.24
185 0.26
186 0.27
187 0.31
188 0.33
189 0.32
190 0.35
191 0.38
192 0.45
193 0.49
194 0.5
195 0.54
196 0.56
197 0.58
198 0.63
199 0.69
200 0.7
201 0.72
202 0.71
203 0.71
204 0.72
205 0.69
206 0.64
207 0.57
208 0.53
209 0.45
210 0.41
211 0.36
212 0.3
213 0.25
214 0.2
215 0.23
216 0.2
217 0.29
218 0.39
219 0.49
220 0.57
221 0.66
222 0.76
223 0.81
224 0.88
225 0.9
226 0.91
227 0.91
228 0.91
229 0.87
230 0.82
231 0.8
232 0.8
233 0.75
234 0.69
235 0.62
236 0.53
237 0.51
238 0.46
239 0.37
240 0.27
241 0.22
242 0.23
243 0.25
244 0.28
245 0.27
246 0.35
247 0.4
248 0.5
249 0.58
250 0.61
251 0.62
252 0.62
253 0.64
254 0.59
255 0.58
256 0.57
257 0.53
258 0.44
259 0.45
260 0.45
261 0.4
262 0.4
263 0.39
264 0.37
265 0.38
266 0.42
267 0.37
268 0.41
269 0.45
270 0.45
271 0.44
272 0.37
273 0.39
274 0.38
275 0.42
276 0.41
277 0.44
278 0.51
279 0.56