Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1RFN0

Protein Details
Accession N1RFN0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-43TDRSGTAEKANKKKNNKTKESKEDLLKEHydrophilic
NLS Segment(s)
PositionSequence
24-75KANKKKNNKTKESKEDLLKEKAELTKEKVGLTKERAALVKALKVKKAEKIRA
Subcellular Location(s) cyto_nucl 10.5, cyto 9.5, mito 9, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MMVPGLVWIRVNLPYTDRSGTAEKANKKKNNKTKESKEDLLKEKAELTKEKVGLTKERAALVKALKVKKAEKIRAETPAKTTAKTIAEMKKLSEFISVRIKRYNRHGAPLSEKMAEEDLKYTIEKMYKHLPNSFVDWEYEEDVDVCRILDLPCYGKSFGKNIEDHLYGKEHLAYDRSMKGRVPLCVQHNRVKREIENGLSYQEGLLAELSVDPYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.26
4 0.24
5 0.25
6 0.26
7 0.28
8 0.33
9 0.38
10 0.43
11 0.51
12 0.6
13 0.64
14 0.71
15 0.79
16 0.81
17 0.84
18 0.86
19 0.87
20 0.88
21 0.9
22 0.88
23 0.84
24 0.82
25 0.8
26 0.75
27 0.71
28 0.61
29 0.51
30 0.47
31 0.44
32 0.39
33 0.35
34 0.34
35 0.35
36 0.35
37 0.36
38 0.35
39 0.34
40 0.36
41 0.38
42 0.38
43 0.33
44 0.35
45 0.34
46 0.31
47 0.32
48 0.28
49 0.28
50 0.29
51 0.29
52 0.29
53 0.33
54 0.34
55 0.38
56 0.46
57 0.49
58 0.48
59 0.52
60 0.52
61 0.57
62 0.58
63 0.52
64 0.46
65 0.48
66 0.43
67 0.37
68 0.34
69 0.3
70 0.27
71 0.28
72 0.3
73 0.26
74 0.3
75 0.29
76 0.3
77 0.28
78 0.27
79 0.25
80 0.24
81 0.19
82 0.18
83 0.28
84 0.29
85 0.27
86 0.33
87 0.34
88 0.32
89 0.4
90 0.47
91 0.37
92 0.42
93 0.43
94 0.4
95 0.44
96 0.45
97 0.39
98 0.29
99 0.28
100 0.23
101 0.21
102 0.19
103 0.13
104 0.11
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.12
111 0.12
112 0.14
113 0.22
114 0.25
115 0.28
116 0.3
117 0.31
118 0.3
119 0.33
120 0.32
121 0.25
122 0.21
123 0.2
124 0.19
125 0.17
126 0.16
127 0.12
128 0.1
129 0.1
130 0.09
131 0.08
132 0.06
133 0.05
134 0.06
135 0.06
136 0.08
137 0.09
138 0.11
139 0.13
140 0.16
141 0.17
142 0.19
143 0.2
144 0.22
145 0.26
146 0.28
147 0.27
148 0.28
149 0.32
150 0.31
151 0.3
152 0.29
153 0.27
154 0.22
155 0.22
156 0.21
157 0.16
158 0.16
159 0.17
160 0.16
161 0.17
162 0.23
163 0.24
164 0.24
165 0.24
166 0.29
167 0.31
168 0.33
169 0.34
170 0.35
171 0.4
172 0.48
173 0.53
174 0.56
175 0.6
176 0.62
177 0.62
178 0.6
179 0.55
180 0.53
181 0.54
182 0.49
183 0.46
184 0.42
185 0.39
186 0.34
187 0.32
188 0.24
189 0.2
190 0.15
191 0.11
192 0.1
193 0.08
194 0.07
195 0.08
196 0.09