Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1RL37

Protein Details
Accession N1RL37   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-31VETRYKWPTNHWPKDKKYKELHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.833, cyto 11.5, nucl 10, cyto_mito 8.666, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Amino Acid Sequences MLKEVGFVDVVETRYKWPTNHWPKDKKYKELGQWNNVNAASALEALTMAPFTRGLGWSREEVEVFLVKLRQDWNNPKIHAYWPICVTYAKKPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.22
4 0.27
5 0.37
6 0.46
7 0.56
8 0.63
9 0.68
10 0.74
11 0.84
12 0.83
13 0.79
14 0.77
15 0.74
16 0.72
17 0.74
18 0.72
19 0.69
20 0.67
21 0.61
22 0.56
23 0.47
24 0.39
25 0.28
26 0.21
27 0.13
28 0.09
29 0.08
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.06
41 0.07
42 0.09
43 0.11
44 0.12
45 0.14
46 0.15
47 0.14
48 0.13
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.1
55 0.12
56 0.15
57 0.17
58 0.24
59 0.33
60 0.39
61 0.45
62 0.46
63 0.46
64 0.46
65 0.45
66 0.47
67 0.41
68 0.39
69 0.34
70 0.35
71 0.34
72 0.34
73 0.34
74 0.34