Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CU76

Protein Details
Accession B0CU76   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
90-118TKGTMEYIFKKKRRKGYQKTIQHKQPYTRHydrophilic
NLS Segment(s)
PositionSequence
99-104KKKRRK
Subcellular Location(s) cyto_nucl 15.833, nucl 13, mito_nucl 9.997, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
IPR001787  Ribosomal_L21  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lbc:LACBIDRAFT_229249  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences PAVIPDSTTSALELIRSQPSQYVVASFAGKKYILTPRDLLTVPRLRDVKVGDVLQLDEIHELGSREYTLRGNPVIPPSRVQVEATVVEHTKGTMEYIFKKKRRKGYQKTIQHKQPYTRLRIGDIEIPIAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.17
4 0.17
5 0.19
6 0.21
7 0.22
8 0.2
9 0.19
10 0.15
11 0.17
12 0.18
13 0.17
14 0.15
15 0.15
16 0.15
17 0.13
18 0.16
19 0.23
20 0.22
21 0.25
22 0.26
23 0.25
24 0.29
25 0.29
26 0.26
27 0.26
28 0.3
29 0.28
30 0.31
31 0.31
32 0.28
33 0.3
34 0.31
35 0.27
36 0.24
37 0.24
38 0.19
39 0.18
40 0.18
41 0.16
42 0.14
43 0.11
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.11
60 0.17
61 0.2
62 0.19
63 0.21
64 0.21
65 0.22
66 0.23
67 0.22
68 0.17
69 0.15
70 0.16
71 0.15
72 0.15
73 0.13
74 0.13
75 0.12
76 0.11
77 0.09
78 0.08
79 0.08
80 0.08
81 0.1
82 0.17
83 0.27
84 0.36
85 0.42
86 0.52
87 0.58
88 0.67
89 0.76
90 0.8
91 0.82
92 0.84
93 0.88
94 0.89
95 0.92
96 0.91
97 0.89
98 0.88
99 0.83
100 0.79
101 0.78
102 0.76
103 0.74
104 0.71
105 0.63
106 0.58
107 0.55
108 0.51
109 0.47
110 0.39
111 0.34