Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U9N5

Protein Details
Accession N4U9N5   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
180-203ELAQLKRGKKRKAVPNPNKRFMTLHydrophilic
247-272EENIPHQPLRRSRRMVKKTRVQYINPHydrophilic
NLS Segment(s)
PositionSequence
185-194KRGKKRKAVP
Subcellular Location(s) nucl 11, cyto 8.5, cyto_mito 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences TSPNGWTDDHIGIEWLERVYLPQTTPADDSDARLIILDGHGSHATDEWMATCFLNNVYCCYLPAHCSHGLQPLDNGVFNASKAAYRRELEKFASLTDSAPMDKVNFIRAYAKARRAGMTKKNILSGWRVTGNWPISHDTHLGLNKTPKTRRRYNVIAKGFEAHQQTVAAHTLRIASLEEELAQLKRGKKRKAVPNPNKRFMTLGETLAGKESIPEGATRYTPVGVEFVSSSEQELESEAGSVIEVREENIPHQPLRRSRRMVKKTRVQYINPIYDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.12
3 0.1
4 0.09
5 0.11
6 0.12
7 0.14
8 0.13
9 0.19
10 0.2
11 0.23
12 0.24
13 0.24
14 0.27
15 0.25
16 0.27
17 0.23
18 0.22
19 0.19
20 0.18
21 0.17
22 0.12
23 0.12
24 0.11
25 0.08
26 0.1
27 0.11
28 0.11
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.07
35 0.08
36 0.09
37 0.08
38 0.08
39 0.08
40 0.09
41 0.13
42 0.13
43 0.15
44 0.17
45 0.17
46 0.18
47 0.19
48 0.19
49 0.17
50 0.19
51 0.21
52 0.2
53 0.21
54 0.22
55 0.28
56 0.28
57 0.26
58 0.24
59 0.23
60 0.22
61 0.21
62 0.19
63 0.13
64 0.12
65 0.11
66 0.12
67 0.08
68 0.1
69 0.11
70 0.15
71 0.18
72 0.18
73 0.23
74 0.26
75 0.3
76 0.3
77 0.32
78 0.29
79 0.25
80 0.26
81 0.22
82 0.18
83 0.16
84 0.14
85 0.11
86 0.1
87 0.1
88 0.08
89 0.1
90 0.1
91 0.12
92 0.12
93 0.12
94 0.15
95 0.16
96 0.23
97 0.26
98 0.3
99 0.31
100 0.31
101 0.33
102 0.34
103 0.4
104 0.41
105 0.44
106 0.44
107 0.41
108 0.43
109 0.41
110 0.39
111 0.35
112 0.28
113 0.23
114 0.19
115 0.18
116 0.17
117 0.22
118 0.22
119 0.19
120 0.19
121 0.19
122 0.18
123 0.2
124 0.19
125 0.14
126 0.15
127 0.17
128 0.16
129 0.15
130 0.19
131 0.21
132 0.27
133 0.32
134 0.37
135 0.42
136 0.5
137 0.53
138 0.56
139 0.62
140 0.66
141 0.7
142 0.68
143 0.62
144 0.54
145 0.51
146 0.44
147 0.39
148 0.31
149 0.21
150 0.16
151 0.15
152 0.14
153 0.14
154 0.15
155 0.11
156 0.09
157 0.09
158 0.09
159 0.08
160 0.09
161 0.08
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.08
168 0.08
169 0.1
170 0.13
171 0.18
172 0.26
173 0.34
174 0.39
175 0.46
176 0.55
177 0.64
178 0.72
179 0.78
180 0.81
181 0.85
182 0.88
183 0.89
184 0.81
185 0.71
186 0.61
187 0.52
188 0.47
189 0.38
190 0.3
191 0.23
192 0.22
193 0.21
194 0.2
195 0.18
196 0.11
197 0.09
198 0.08
199 0.08
200 0.08
201 0.08
202 0.09
203 0.11
204 0.12
205 0.13
206 0.13
207 0.13
208 0.13
209 0.13
210 0.12
211 0.1
212 0.11
213 0.1
214 0.1
215 0.11
216 0.11
217 0.11
218 0.11
219 0.11
220 0.1
221 0.11
222 0.1
223 0.09
224 0.09
225 0.08
226 0.07
227 0.07
228 0.07
229 0.06
230 0.07
231 0.07
232 0.08
233 0.11
234 0.12
235 0.14
236 0.21
237 0.24
238 0.25
239 0.31
240 0.38
241 0.44
242 0.52
243 0.6
244 0.62
245 0.68
246 0.77
247 0.83
248 0.85
249 0.86
250 0.87
251 0.87
252 0.89
253 0.87
254 0.79
255 0.79
256 0.79