Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4TT04

Protein Details
Accession N4TT04   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
6-34QSPYQHHRYKYRYQRPRSQSPPQRRRGSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences RLADGQSPYQHHRYKYRYQRPRSQSPPQRRRGSIDRNDPGPTERGPTSNGGPLGYGPPGYGPPRLNFNGHQLPACIEDEELTKEYVLSDISRSASQPAGQNADGPEDLVFGEVHPLFQMYSELSKVANPPPCLLSRAFEASLKKLLRIGLLLWML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.74
4 0.76
5 0.8
6 0.85
7 0.84
8 0.88
9 0.85
10 0.85
11 0.84
12 0.85
13 0.87
14 0.86
15 0.86
16 0.78
17 0.78
18 0.76
19 0.76
20 0.74
21 0.74
22 0.7
23 0.64
24 0.63
25 0.56
26 0.48
27 0.4
28 0.32
29 0.25
30 0.21
31 0.2
32 0.2
33 0.21
34 0.21
35 0.22
36 0.22
37 0.17
38 0.16
39 0.16
40 0.15
41 0.13
42 0.11
43 0.07
44 0.07
45 0.09
46 0.11
47 0.14
48 0.14
49 0.15
50 0.2
51 0.22
52 0.24
53 0.23
54 0.28
55 0.3
56 0.29
57 0.28
58 0.23
59 0.22
60 0.22
61 0.21
62 0.14
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.05
76 0.07
77 0.08
78 0.09
79 0.09
80 0.1
81 0.1
82 0.12
83 0.14
84 0.15
85 0.17
86 0.17
87 0.18
88 0.17
89 0.19
90 0.17
91 0.14
92 0.12
93 0.09
94 0.09
95 0.08
96 0.07
97 0.05
98 0.09
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.07
107 0.08
108 0.09
109 0.09
110 0.09
111 0.11
112 0.13
113 0.19
114 0.24
115 0.24
116 0.25
117 0.28
118 0.3
119 0.31
120 0.29
121 0.26
122 0.24
123 0.27
124 0.27
125 0.27
126 0.29
127 0.3
128 0.36
129 0.35
130 0.31
131 0.29
132 0.28
133 0.26
134 0.25
135 0.22