Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4UMW7

Protein Details
Accession N4UMW7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
50-73YGSYGAKPKPKPKPAPAPKKYTNYHydrophilic
128-151YGSYGAKPKPKPKPAPAPKKYTNYHydrophilic
NLS Segment(s)
PositionSequence
56-69KPKPKPKPAPAPKK
134-147KPKPKPKPAPAPKK
Subcellular Location(s) extr 19, mito 2, cyto 2, E.R. 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKFTAVTLLTLAAGAMAAPVAEAAPEAAPGYTTYGDYKGAGENLPSYPSYGSYGAKPKPKPKPAPAPKKYTNYGSYNYKKYSSYGHYKREAEPEAAPEAAPEAEAAPGYTTYGDYKGAGENLPSYPSYGSYGAKPKPKPKPAPAPKKYTNYGSYNYKKYSSYGHYKREAEPEAAPEAEAEPETYSKYGSYPKKYTNYGSYNYKKYSSYGTYKRAKEFINSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.09
18 0.09
19 0.1
20 0.12
21 0.13
22 0.14
23 0.14
24 0.14
25 0.13
26 0.14
27 0.13
28 0.13
29 0.13
30 0.13
31 0.15
32 0.14
33 0.13
34 0.12
35 0.13
36 0.15
37 0.15
38 0.15
39 0.18
40 0.26
41 0.3
42 0.37
43 0.42
44 0.48
45 0.56
46 0.65
47 0.69
48 0.71
49 0.77
50 0.8
51 0.86
52 0.84
53 0.83
54 0.8
55 0.78
56 0.72
57 0.67
58 0.62
59 0.54
60 0.52
61 0.53
62 0.51
63 0.5
64 0.48
65 0.44
66 0.39
67 0.36
68 0.37
69 0.33
70 0.38
71 0.4
72 0.44
73 0.49
74 0.51
75 0.52
76 0.53
77 0.49
78 0.4
79 0.34
80 0.29
81 0.24
82 0.22
83 0.19
84 0.13
85 0.11
86 0.09
87 0.08
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.07
99 0.08
100 0.09
101 0.09
102 0.11
103 0.13
104 0.14
105 0.13
106 0.13
107 0.13
108 0.13
109 0.15
110 0.14
111 0.13
112 0.12
113 0.13
114 0.15
115 0.15
116 0.15
117 0.18
118 0.26
119 0.3
120 0.37
121 0.42
122 0.48
123 0.56
124 0.65
125 0.69
126 0.71
127 0.77
128 0.8
129 0.86
130 0.84
131 0.83
132 0.8
133 0.78
134 0.72
135 0.67
136 0.62
137 0.54
138 0.52
139 0.53
140 0.51
141 0.5
142 0.48
143 0.44
144 0.39
145 0.36
146 0.37
147 0.33
148 0.38
149 0.4
150 0.44
151 0.49
152 0.51
153 0.52
154 0.53
155 0.49
156 0.4
157 0.34
158 0.29
159 0.26
160 0.23
161 0.2
162 0.15
163 0.13
164 0.12
165 0.11
166 0.1
167 0.08
168 0.09
169 0.1
170 0.1
171 0.1
172 0.1
173 0.12
174 0.2
175 0.27
176 0.35
177 0.39
178 0.47
179 0.53
180 0.57
181 0.6
182 0.61
183 0.59
184 0.55
185 0.59
186 0.57
187 0.55
188 0.53
189 0.5
190 0.41
191 0.37
192 0.4
193 0.38
194 0.42
195 0.45
196 0.52
197 0.59
198 0.64
199 0.68
200 0.66
201 0.6
202 0.57