Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DIR0

Protein Details
Accession B0DIR0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-72GSSYSRVGPRCRRWKMKKRGRGEBasic
NLS Segment(s)
PositionSequence
61-72RRWKMKKRGRGE
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024050  AICAR_Tfase_insert_dom_sf  
KEGG lbc:LACBIDRAFT_302980  -  
Amino Acid Sequences MYPSSRRESRPVVTHASLLPLIKGVKRAEKANAVDPFDSGEVLEGEMNGGSSYSRVGPRCRRWKMKKRGRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.37
4 0.32
5 0.24
6 0.2
7 0.15
8 0.15
9 0.13
10 0.18
11 0.17
12 0.22
13 0.24
14 0.26
15 0.27
16 0.32
17 0.33
18 0.36
19 0.38
20 0.33
21 0.31
22 0.28
23 0.26
24 0.2
25 0.18
26 0.1
27 0.07
28 0.05
29 0.06
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.05
40 0.07
41 0.12
42 0.15
43 0.24
44 0.34
45 0.44
46 0.55
47 0.64
48 0.73
49 0.79
50 0.88
51 0.91
52 0.92