Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CUT3

Protein Details
Accession B0CUT3    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSTRSKVKRAFRSKKRETGIYAHydrophilic
NLS Segment(s)
PositionSequence
7-18SKVKRAFRSKKR
88-128GSRRDEWRTSKGLDPRPKPTGMNRQGGIAARRKSGRSKRRR
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG lbc:LACBIDRAFT_192455  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSTRSKVKRAFRSKKRETGIYAATEAARLNRLNSKLVQIATRQGEGEEEKGEEDMLAEVDQSATVADAIVIDGQKSERISTHGPRGSRRDEWRTSKGLDPRPKPTGMNRQGGIAARRKSGRSKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.85
5 0.8
6 0.74
7 0.7
8 0.64
9 0.56
10 0.47
11 0.39
12 0.32
13 0.27
14 0.22
15 0.16
16 0.15
17 0.12
18 0.14
19 0.18
20 0.2
21 0.22
22 0.23
23 0.25
24 0.25
25 0.26
26 0.25
27 0.21
28 0.25
29 0.24
30 0.24
31 0.2
32 0.17
33 0.18
34 0.17
35 0.17
36 0.12
37 0.1
38 0.09
39 0.09
40 0.09
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.06
64 0.06
65 0.07
66 0.07
67 0.11
68 0.16
69 0.19
70 0.28
71 0.3
72 0.31
73 0.36
74 0.41
75 0.43
76 0.46
77 0.5
78 0.49
79 0.54
80 0.6
81 0.6
82 0.59
83 0.56
84 0.55
85 0.56
86 0.58
87 0.59
88 0.57
89 0.59
90 0.59
91 0.59
92 0.55
93 0.56
94 0.58
95 0.56
96 0.58
97 0.51
98 0.48
99 0.49
100 0.5
101 0.47
102 0.44
103 0.39
104 0.38
105 0.41
106 0.43
107 0.5
108 0.57