Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DKA5

Protein Details
Accession B0DKA5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
154-186GMGPHKNKKPYTQSKGRKFEQGRGRRKSRGFKVBasic
NLS Segment(s)
PositionSequence
157-186PHKNKKPYTQSKGRKFEQGRGRRKSRGFKV
Subcellular Location(s) mito 11, cyto_nucl 8, nucl 7.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lbc:LACBIDRAFT_320115  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MGIDITAHHVKKGARTAPKSEDPYLLLLVKLYRFLARRTDANFNKVILHRLFLSKTNRPPLSLSRIVKETSHTPERESKIIVQVGTVTDDIRLTEVPKLTIAALRFTRAAKERILNAGGEAITLDQLALRSPKGSNTVLLRGVKTAREAYKHFGMGPHKNKKPYTQSKGRKFEQGRGRRKSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.55
4 0.59
5 0.66
6 0.66
7 0.6
8 0.55
9 0.47
10 0.44
11 0.4
12 0.32
13 0.24
14 0.19
15 0.18
16 0.15
17 0.15
18 0.14
19 0.16
20 0.17
21 0.19
22 0.25
23 0.27
24 0.31
25 0.34
26 0.44
27 0.43
28 0.45
29 0.44
30 0.38
31 0.39
32 0.36
33 0.37
34 0.27
35 0.25
36 0.22
37 0.24
38 0.25
39 0.26
40 0.31
41 0.33
42 0.39
43 0.46
44 0.45
45 0.44
46 0.46
47 0.45
48 0.46
49 0.47
50 0.43
51 0.36
52 0.38
53 0.37
54 0.34
55 0.32
56 0.28
57 0.26
58 0.31
59 0.28
60 0.29
61 0.35
62 0.38
63 0.37
64 0.34
65 0.28
66 0.27
67 0.28
68 0.25
69 0.18
70 0.15
71 0.14
72 0.14
73 0.12
74 0.08
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.08
82 0.08
83 0.08
84 0.08
85 0.09
86 0.08
87 0.1
88 0.1
89 0.12
90 0.12
91 0.13
92 0.14
93 0.13
94 0.17
95 0.18
96 0.19
97 0.18
98 0.2
99 0.2
100 0.22
101 0.23
102 0.2
103 0.17
104 0.16
105 0.13
106 0.11
107 0.09
108 0.06
109 0.05
110 0.05
111 0.04
112 0.03
113 0.04
114 0.05
115 0.06
116 0.06
117 0.08
118 0.08
119 0.11
120 0.15
121 0.16
122 0.18
123 0.21
124 0.24
125 0.28
126 0.3
127 0.28
128 0.26
129 0.27
130 0.24
131 0.24
132 0.26
133 0.24
134 0.27
135 0.29
136 0.33
137 0.36
138 0.36
139 0.34
140 0.33
141 0.37
142 0.43
143 0.5
144 0.54
145 0.56
146 0.62
147 0.65
148 0.68
149 0.72
150 0.73
151 0.73
152 0.74
153 0.78
154 0.82
155 0.88
156 0.82
157 0.82
158 0.75
159 0.74
160 0.74
161 0.74
162 0.74
163 0.75
164 0.79
165 0.78
166 0.82