Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4TVS4

Protein Details
Accession N4TVS4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-110PRENSNAPKRQRNKHDSRHLTNTLHydrophilic
NLS Segment(s)
PositionSequence
30-100APRKRRENDRRSGNAPRENSNAPRKRRENDRRSGNAPRENSNAPRKRRENDRRSGNAPRENSNAPKRQRNK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAHQRSVGELEKLLQEAVQCGNAPRENSNAPRKRRENDRRSGNAPRENSNAPRKRRENDRRSGNAPRENSNAPRKRRENDRRSGNAPRENSNAPKRQRNKHDSRHLTNTLQLAMLPFSLASPSKQIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.13
5 0.13
6 0.12
7 0.12
8 0.18
9 0.2
10 0.21
11 0.21
12 0.24
13 0.27
14 0.34
15 0.44
16 0.47
17 0.51
18 0.59
19 0.64
20 0.65
21 0.72
22 0.76
23 0.74
24 0.76
25 0.79
26 0.75
27 0.74
28 0.77
29 0.73
30 0.69
31 0.62
32 0.56
33 0.51
34 0.48
35 0.5
36 0.52
37 0.52
38 0.52
39 0.59
40 0.62
41 0.64
42 0.72
43 0.76
44 0.74
45 0.76
46 0.79
47 0.75
48 0.74
49 0.77
50 0.73
51 0.69
52 0.62
53 0.56
54 0.51
55 0.48
56 0.5
57 0.52
58 0.52
59 0.52
60 0.59
61 0.62
62 0.64
63 0.72
64 0.76
65 0.74
66 0.76
67 0.79
68 0.75
69 0.74
70 0.77
71 0.73
72 0.69
73 0.62
74 0.56
75 0.51
76 0.48
77 0.5
78 0.5
79 0.5
80 0.49
81 0.57
82 0.61
83 0.67
84 0.74
85 0.77
86 0.79
87 0.81
88 0.86
89 0.86
90 0.85
91 0.84
92 0.79
93 0.71
94 0.64
95 0.56
96 0.45
97 0.36
98 0.28
99 0.21
100 0.16
101 0.14
102 0.1
103 0.08
104 0.07
105 0.1
106 0.1
107 0.11
108 0.16