Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4TZW5

Protein Details
Accession N4TZW5    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKVKKELIHKAKVBasic
170-189REKFKKAMAKTRDRNGNKKLBasic
NLS Segment(s)
PositionSequence
17-62KKPKHGFRVGPENLPDGPWRRKVTKVKKELIHKAKVKKAYAKIKAR
152-191KRREFERRQEERAQKIAEREKFKKAMAKTRDRNGNKKLGR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MAPKHQNEGGDAAPEAKKPKHGFRVGPENLPDGPWRRKVTKVKKELIHKAKVKKAYAKIKAREQQNAPAPKTSEPVQDEAPVEDTREEKQPEKEGEEMHPTRQLMLADEAKAQENSVGEPTSDGNRRRTRRPGYYDKQLAKAAQRQEEAEMKRREFERRQEERAQKIAEREKFKKAMAKTRDRNGNKKLGRESSLLLDKVRKLVAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.23
4 0.3
5 0.34
6 0.43
7 0.49
8 0.55
9 0.58
10 0.62
11 0.71
12 0.66
13 0.66
14 0.58
15 0.51
16 0.44
17 0.4
18 0.36
19 0.32
20 0.34
21 0.37
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.74
30 0.76
31 0.82
32 0.83
33 0.81
34 0.79
35 0.76
36 0.75
37 0.74
38 0.74
39 0.7
40 0.67
41 0.68
42 0.68
43 0.71
44 0.72
45 0.71
46 0.73
47 0.74
48 0.71
49 0.69
50 0.62
51 0.6
52 0.59
53 0.61
54 0.53
55 0.5
56 0.47
57 0.4
58 0.39
59 0.33
60 0.31
61 0.25
62 0.26
63 0.23
64 0.24
65 0.23
66 0.21
67 0.22
68 0.16
69 0.15
70 0.13
71 0.13
72 0.12
73 0.17
74 0.18
75 0.18
76 0.21
77 0.26
78 0.27
79 0.28
80 0.29
81 0.25
82 0.25
83 0.3
84 0.28
85 0.24
86 0.25
87 0.22
88 0.2
89 0.2
90 0.18
91 0.11
92 0.14
93 0.14
94 0.12
95 0.13
96 0.13
97 0.12
98 0.12
99 0.11
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.08
107 0.09
108 0.12
109 0.17
110 0.19
111 0.26
112 0.35
113 0.39
114 0.45
115 0.53
116 0.57
117 0.61
118 0.67
119 0.69
120 0.67
121 0.73
122 0.75
123 0.69
124 0.65
125 0.58
126 0.52
127 0.46
128 0.45
129 0.4
130 0.37
131 0.35
132 0.32
133 0.33
134 0.38
135 0.37
136 0.4
137 0.4
138 0.36
139 0.39
140 0.41
141 0.45
142 0.45
143 0.51
144 0.53
145 0.55
146 0.61
147 0.66
148 0.71
149 0.7
150 0.7
151 0.63
152 0.55
153 0.56
154 0.58
155 0.56
156 0.57
157 0.55
158 0.57
159 0.57
160 0.57
161 0.56
162 0.54
163 0.56
164 0.57
165 0.64
166 0.64
167 0.7
168 0.78
169 0.78
170 0.81
171 0.78
172 0.79
173 0.73
174 0.72
175 0.71
176 0.67
177 0.64
178 0.58
179 0.53
180 0.5
181 0.52
182 0.46
183 0.4
184 0.39
185 0.37
186 0.38
187 0.36