Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4U7U5

Protein Details
Accession N4U7U5    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
67-89EEERRGRERVRRNYSRSGKSHKKBasic
NLS Segment(s)
PositionSequence
70-89RRGRERVRRNYSRSGKSHKK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MAHTTETYYYYVPNLQALDPTAREVDPSAYAWVQPTIIEDEDLTFGGKALSTWYEEDRRRHSSGSDEEERRGRERVRRNYSRSGKSHKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.17
5 0.18
6 0.15
7 0.17
8 0.16
9 0.14
10 0.14
11 0.14
12 0.13
13 0.12
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.12
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.08
28 0.09
29 0.09
30 0.08
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.05
38 0.06
39 0.08
40 0.11
41 0.18
42 0.22
43 0.27
44 0.32
45 0.37
46 0.38
47 0.38
48 0.36
49 0.36
50 0.38
51 0.41
52 0.44
53 0.4
54 0.42
55 0.46
56 0.47
57 0.43
58 0.42
59 0.39
60 0.4
61 0.49
62 0.56
63 0.62
64 0.69
65 0.73
66 0.79
67 0.83
68 0.84
69 0.81