Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CNY3

Protein Details
Accession B0CNY3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-49SETQWWPRRRGRWRFRCHSGLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 8.5, cyto 5.5, extr 5, plas 3
Family & Domain DBs
KEGG lbc:LACBIDRAFT_301628  -  
Amino Acid Sequences MYLPRILTVDSLVSAHLGVNMWSPRPWSSETQWWPRRRGRWRFRCHSGLFSGEARGTHLAARCCIACWFAKWRWVLVDGPQCWIPSVGAFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.06
6 0.11
7 0.12
8 0.13
9 0.13
10 0.15
11 0.15
12 0.18
13 0.21
14 0.21
15 0.24
16 0.33
17 0.39
18 0.48
19 0.55
20 0.56
21 0.6
22 0.62
23 0.66
24 0.67
25 0.71
26 0.72
27 0.74
28 0.79
29 0.8
30 0.81
31 0.79
32 0.7
33 0.63
34 0.53
35 0.44
36 0.37
37 0.29
38 0.24
39 0.17
40 0.15
41 0.14
42 0.12
43 0.11
44 0.11
45 0.14
46 0.14
47 0.14
48 0.16
49 0.14
50 0.15
51 0.15
52 0.14
53 0.12
54 0.14
55 0.2
56 0.22
57 0.27
58 0.27
59 0.28
60 0.28
61 0.3
62 0.28
63 0.3
64 0.36
65 0.31
66 0.34
67 0.34
68 0.32
69 0.31
70 0.3
71 0.23